NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208063_1027910

Scaffold Ga0208063_1027910


Overview

Basic Information
Taxon OID3300025204 Open in IMG/M
Scaffold IDGa0208063_1027910 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP0203 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)794
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameSouth of Cape Verde, Atlantic Ocean
CoordinatesLat. (o)7.33Long. (o)-26.0Alt. (m)Depth (m)4002.51
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020717Metagenome / Metatranscriptome222Y

Sequences

Protein IDFamilyRBSSequence
Ga0208063_10279101F020717N/ASIVACTRFLALLETTQCWDFLRPHHILHENKDIRCFRDLNEQKDISISVLKLMLSEN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.