| Basic Information | |
|---|---|
| Taxon OID | 3300025200 Open in IMG/M |
| Scaffold ID | Ga0208569_1014892 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from South of Eden, South Pacific Ocean - MP1434 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 689 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South of Eden, South Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -38.64 | Long. (o) | 150.41 | Alt. (m) | Depth (m) | 4001.15 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045803 | Metagenome | 152 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208569_10148922 | F045803 | N/A | MLKLFRISILLLFFSLIIPNLSFSNDLIERIKKIEKSVSDAEDAFAIGSKGHFQSLEKLLEVRKKLVKAKDMFAEIKTYENKLETAHYRNTTIRILDDLEPLTKYIIEHSGLDP |
| ⦗Top⦘ |