Scaffold Ga0208205_100892

Overview

Basic Information

• Taxon OID: 3300025194
• Scaffold ID: Ga0208205_100892
• Source Dataset Name: Marine microbial communities from the Deep Pacific Ocean - MP1494 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3565
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South of Fiji, South Pacific Ocean
• Coordinates
  • Lat. (^o): -25.49
  • Long. (^o): -179.52
  • Depth (m): 2147.76

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071317	Metagenome / Metatranscriptome	122	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208205_1008924	F071317	AGAAGG	LKKITAVGLITLFAGVTAAPLIHLDECNMPCCAGLATSCCDMDQEVACPTISDCGSSIFVLIVSGPFHKSELKSSDSISQRFVTDLDIFKIETNYIACFGNYDPGPMASLNLPLLI