NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208704_108205

Scaffold Ga0208704_108205


Overview

Basic Information
Taxon OID3300025189 Open in IMG/M
Scaffold IDGa0208704_108205 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP0144 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)517
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameWest of Cape Verde, Atlantic Ocean
CoordinatesLat. (o)14.52Long. (o)-26.0Alt. (m)Depth (m)4005.01
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002078Metagenome / Metatranscriptome596Y
F046426Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0208704_1082051F002078N/AAMFEGQGWFAIVGQIVLVFTAVTGALPDRFVQKIPVLGTLWPIFNWLAGNVFNNINHPKGMAAKAEVEEEIDKAKAKVRQRVGMPDVLDGM
Ga0208704_1082052F046426AGGVLVCLMFLTGCSILPQLIAPAANFAIGFYDANDYYSKECLWYDEVKLNAETKKWFMDNTPPEGVARDLSVVSRNNDIYKEVCKEHKSVADK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.