Scaffold Ga0208704_107351

Overview

Basic Information

• Taxon OID: 3300025189
• Scaffold ID: Ga0208704_107351
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP0144 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 550
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: West of Cape Verde, Atlantic Ocean
• Coordinates
  • Lat. (^o): 14.52
  • Long. (^o): -26.0
  • Depth (m): 4005.01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012125	Metagenome	283	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208704_1073512	F012125	N/A	MSNTRYSVMHPDGGKDSFFSAGKPKNLPRFYFLVLAGIFL