Scaffold Ga0208333_100298

Overview

Basic Information

• Taxon OID: 3300025169
• Scaffold ID: Ga0208333_100298
• Source Dataset Name: Marine microbial communities from the Deep Indian Ocean - MP1140 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2069
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Indian Ocean
• Coordinates
  • Lat. (^o): -29.65
  • Long. (^o): 92.99
  • Depth (m): 2402.15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033465	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208333_1002982	F033465	AGGA	MEFIFIPLLACILLMIGELSNPRGMNIFWYKLNVIRENYFKELTRYDSGNNKGNGKHSRI