NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025169

3300025169: Marine microbial communities from the Deep Indian Ocean - MP1140 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025169 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054695 | Ga0208333
Sample NameMarine microbial communities from the Deep Indian Ocean - MP1140 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13770270
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium1
Not Available1
All Organisms → Viruses → unclassified viruses → Virus sp.1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouth Indian Ocean
CoordinatesLat. (o)-29.65Long. (o)92.99Alt. (m)N/ADepth (m)2402.15
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033465Metagenome / Metatranscriptome177Y
F043982Metagenome / Metatranscriptome155Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208333_100202All Organisms → Viruses → Predicted Viral2484Open in IMG/M
Ga0208333_100298All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium2069Open in IMG/M
Ga0208333_100907Not Available1107Open in IMG/M
Ga0208333_102325All Organisms → Viruses → unclassified viruses → Virus sp.703Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208333_100202Ga0208333_1002022F033465MAEFLLYTLLFLCIIAMIGENSNPRGMNIFWYKVRVKLKEYWKALREYDSGNNDGNGKF
Ga0208333_100298Ga0208333_1002982F033465MEFIFIPLLACILLMIGELSNPRGMNIFWYKLNVIRENYFKELTRYDSGNNKGNGKHSRI
Ga0208333_100907Ga0208333_1009072F033465MAEFILYTTLFLCIIAMIGENSNPRGMNIFWYKVGVKLKEYWKALKEYDSGN
Ga0208333_102325Ga0208333_1023252F043982CMHQFLLYSVIFVSCISLFLALIACARVGKFINSTAGLDWSSVANITGDLATLKKTIQTLNNRMNGMHSPKIAEQELMMQLLNKQQNQQVNGKIQGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.