Scaffold Ga0209381_1095400

Overview

Basic Information

• Taxon OID: 3300025161
• Scaffold ID: Ga0209381_1095400
• Source Dataset Name: Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1037
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 49.9543
  • Long. (^o): -116.5155

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061147	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209381_10954002	F061147	GGAG	MNSRTRTTTAPSPSLQAQLAQIGLDAVAAELDDFLARATKQRWSPRQ