Scaffold Ga0209535_1093145

Overview

Basic Information

• Taxon OID: 3300025120
• Scaffold ID: Ga0209535_1093145
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1102
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 48.9699
  • Long. (^o): -130.6666

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072249	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209535_10931451	F072249	AGGA	MSYIGQNLPSNSFIGYTTDTFAGDGSTTAFTMSKAPFSESAVIVVINNVVQQPTADF