Scaffold Ga0208667_1048527

Overview

Basic Information

• Taxon OID: 3300025070
• Scaffold ID: Ga0208667_1048527
• Source Dataset Name: Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 693
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): -14.21
  • Long. (^o): -77.52
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105102	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208667_10485273	F105102	N/A	QMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME