NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F105102

Metagenome Family F105102

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105102
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 62 residues
Representative Sequence MKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Number of Associated Samples 75
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 46.00 %
% of genes near scaffold ends (potentially truncated) 31.00 %
% of genes from short scaffolds (< 2000 bps) 74.00 %
Associated GOLD sequencing projects 67
AlphaFold2 3D model prediction Yes
3D model pTM-score0.73

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(22.000 % of family members)
Environment Ontology (ENVO) Unclassified
(70.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 14.44%    β-sheet: 28.89%    Coil/Unstructured: 56.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.73
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.272.1.1: Dystroglycan, domain 2d4wiqa24wiq0.60666
d.142.2.0: automated matchesd7k72a_7k720.60513
d.73.1.1: RuBisCO, small subunitd1wdds_1wdd0.58718
d.58.8.1: Viral DNA-binding domaind6vh6a16vh60.58607
d.142.2.2: Adenylation domain of NAD+-dependent DNA ligased3jsla_3jsl0.58502

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF11351GTA_holin_3TM 28.00
PF01726LexA_DNA_bind 12.00
PF08291Peptidase_M15_3 7.00
PF00959Phage_lysozyme 6.00
PF09588YqaJ 4.00
PF13884Peptidase_S74 2.00
PF13481AAA_25 1.00
PF10263SprT-like 1.00
PF02018CBM_4_9 1.00
PF05354Phage_attach 1.00


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.00 %
UnclassifiedrootN/A14.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10014529All Organisms → cellular organisms → Bacteria → Proteobacteria3979Open in IMG/M
3300000116|DelMOSpr2010_c10046564All Organisms → cellular organisms → Bacteria → Proteobacteria1923Open in IMG/M
3300000116|DelMOSpr2010_c10239571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria558Open in IMG/M
3300000117|DelMOWin2010_c10052487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1787Open in IMG/M
3300000117|DelMOWin2010_c10113780All Organisms → cellular organisms → Bacteria → Proteobacteria961Open in IMG/M
3300002482|JGI25127J35165_1090650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria622Open in IMG/M
3300004097|Ga0055584_100088834All Organisms → cellular organisms → Bacteria3069Open in IMG/M
3300004097|Ga0055584_100814614All Organisms → cellular organisms → Bacteria → Proteobacteria977Open in IMG/M
3300005837|Ga0078893_10660921All Organisms → cellular organisms → Bacteria → Proteobacteria8514Open in IMG/M
3300005837|Ga0078893_10984379All Organisms → cellular organisms → Bacteria20604Open in IMG/M
3300006026|Ga0075478_10000174All Organisms → cellular organisms → Bacteria23133Open in IMG/M
3300006026|Ga0075478_10160700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria698Open in IMG/M
3300006027|Ga0075462_10003070All Organisms → cellular organisms → Bacteria → Proteobacteria5440Open in IMG/M
3300006027|Ga0075462_10014436All Organisms → cellular organisms → Bacteria2546Open in IMG/M
3300006027|Ga0075462_10160538All Organisms → Viruses685Open in IMG/M
3300006029|Ga0075466_1108547Not Available746Open in IMG/M
3300006621|Ga0101441_117072All Organisms → cellular organisms → Bacteria → Proteobacteria5469Open in IMG/M
3300006621|Ga0101441_122452Not Available3875Open in IMG/M
3300006737|Ga0098037_1179310All Organisms → cellular organisms → Bacteria → Proteobacteria701Open in IMG/M
3300006752|Ga0098048_1028030Not Available1847Open in IMG/M
3300006752|Ga0098048_1115617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria807Open in IMG/M
3300006793|Ga0098055_1342266All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium556Open in IMG/M
3300006793|Ga0098055_1381943All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium522Open in IMG/M
3300006810|Ga0070754_10022465All Organisms → cellular organisms → Bacteria → Proteobacteria3649Open in IMG/M
3300006810|Ga0070754_10393388All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium607Open in IMG/M
3300006916|Ga0070750_10207283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria865Open in IMG/M
3300006916|Ga0070750_10358558All Organisms → cellular organisms → Bacteria → Proteobacteria614Open in IMG/M
3300006919|Ga0070746_10177798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1024Open in IMG/M
3300006919|Ga0070746_10446528Not Available574Open in IMG/M
3300006922|Ga0098045_1019075All Organisms → Viruses → Predicted Viral1844Open in IMG/M
3300006924|Ga0098051_1008319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-20113221Open in IMG/M
3300007640|Ga0070751_1327502Not Available566Open in IMG/M
3300009001|Ga0102963_1414817All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300009124|Ga0118687_10017348All Organisms → cellular organisms → Bacteria → Proteobacteria2362Open in IMG/M
3300009124|Ga0118687_10420595All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300009435|Ga0115546_1112734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria980Open in IMG/M
3300010149|Ga0098049_1151441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria717Open in IMG/M
3300010150|Ga0098056_1196643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.674Open in IMG/M
3300010296|Ga0129348_1316013All Organisms → cellular organisms → Bacteria → Proteobacteria520Open in IMG/M
3300011127|Ga0151665_1084638All Organisms → cellular organisms → Bacteria → Proteobacteria571Open in IMG/M
3300011253|Ga0151671_1139755All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium564Open in IMG/M
3300011258|Ga0151677_1035419All Organisms → cellular organisms → Bacteria → Proteobacteria2440Open in IMG/M
3300012284|Ga0116696_1074753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria631Open in IMG/M
3300012920|Ga0160423_10025782All Organisms → cellular organisms → Bacteria → Proteobacteria4379Open in IMG/M
3300012952|Ga0163180_10313304All Organisms → cellular organisms → Bacteria → Proteobacteria1119Open in IMG/M
3300017697|Ga0180120_10139094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1035Open in IMG/M
3300017708|Ga0181369_1000171All Organisms → cellular organisms → Bacteria18575Open in IMG/M
3300017710|Ga0181403_1006660All Organisms → cellular organisms → Bacteria → Proteobacteria2518Open in IMG/M
3300017713|Ga0181391_1003260All Organisms → cellular organisms → Bacteria → Proteobacteria4481Open in IMG/M
3300017713|Ga0181391_1033535All Organisms → cellular organisms → Bacteria → Proteobacteria1245Open in IMG/M
3300017720|Ga0181383_1101007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria775Open in IMG/M
3300017726|Ga0181381_1026677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1304Open in IMG/M
3300017731|Ga0181416_1059921Not Available899Open in IMG/M
3300017748|Ga0181393_1122124All Organisms → cellular organisms → Bacteria → Proteobacteria660Open in IMG/M
3300017755|Ga0181411_1037456All Organisms → cellular organisms → Bacteria → Proteobacteria1524Open in IMG/M
3300017759|Ga0181414_1038270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1293Open in IMG/M
3300017760|Ga0181408_1114536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria699Open in IMG/M
3300017765|Ga0181413_1074305Not Available1041Open in IMG/M
3300017768|Ga0187220_1101688All Organisms → cellular organisms → Bacteria → Proteobacteria869Open in IMG/M
3300017776|Ga0181394_1039930All Organisms → cellular organisms → Bacteria → Proteobacteria1614Open in IMG/M
3300017782|Ga0181380_1006886All Organisms → cellular organisms → Bacteria → Proteobacteria4533Open in IMG/M
3300017951|Ga0181577_10220701All Organisms → cellular organisms → Bacteria → Proteobacteria1258Open in IMG/M
3300017957|Ga0181571_10940207Not Available507Open in IMG/M
3300017969|Ga0181585_10978087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria540Open in IMG/M
3300018421|Ga0181592_10326358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium TMED1111103Open in IMG/M
3300019750|Ga0194000_1076604All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium544Open in IMG/M
3300020403|Ga0211532_10382270All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300020438|Ga0211576_10354573All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria755Open in IMG/M
3300020439|Ga0211558_10110202All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alteromonas/Salinimonas group → Alteromonas → Alteromonas australica1340Open in IMG/M
3300021335|Ga0213867_1149072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.804Open in IMG/M
3300021356|Ga0213858_10097769All Organisms → cellular organisms → Bacteria → Proteobacteria1433Open in IMG/M
3300021364|Ga0213859_10314645All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300021364|Ga0213859_10361231All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium648Open in IMG/M
3300021957|Ga0222717_10370618All Organisms → cellular organisms → Bacteria → Proteobacteria799Open in IMG/M
3300021957|Ga0222717_10462212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria690Open in IMG/M
3300021958|Ga0222718_10009623All Organisms → cellular organisms → Bacteria7318Open in IMG/M
3300021958|Ga0222718_10016433All Organisms → cellular organisms → Bacteria → Proteobacteria5250Open in IMG/M
3300021959|Ga0222716_10210417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Alteromonas phage PB151225Open in IMG/M
3300022065|Ga0212024_1030557All Organisms → cellular organisms → Bacteria → Proteobacteria913Open in IMG/M
3300022068|Ga0212021_1012223Not Available1487Open in IMG/M
3300022068|Ga0212021_1023209All Organisms → Viruses → Predicted Viral1174Open in IMG/M
3300022068|Ga0212021_1027265All Organisms → Viruses → Predicted Viral1101Open in IMG/M
3300022069|Ga0212026_1019339Not Available955Open in IMG/M
3300022071|Ga0212028_1112703All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium504Open in IMG/M
3300022074|Ga0224906_1001594All Organisms → cellular organisms → Bacteria → Proteobacteria11085Open in IMG/M
3300022074|Ga0224906_1005119All Organisms → cellular organisms → Bacteria → Proteobacteria5548Open in IMG/M
3300022074|Ga0224906_1011365All Organisms → cellular organisms → Bacteria → Proteobacteria3426Open in IMG/M
3300022074|Ga0224906_1071844Not Available1063Open in IMG/M
3300022183|Ga0196891_1045441Not Available805Open in IMG/M
3300025070|Ga0208667_1048527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria693Open in IMG/M
3300025084|Ga0208298_1107235All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300025098|Ga0208434_1040770All Organisms → cellular organisms → Bacteria → Proteobacteria1051Open in IMG/M
3300025108|Ga0208793_1006201Not Available5229Open in IMG/M
3300025108|Ga0208793_1036316All Organisms → cellular organisms → Bacteria → Proteobacteria1602Open in IMG/M
3300025647|Ga0208160_1152779All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300025828|Ga0208547_1026994All Organisms → cellular organisms → Bacteria → Proteobacteria2228Open in IMG/M
3300029309|Ga0183683_1000873All Organisms → cellular organisms → Bacteria → Proteobacteria13715Open in IMG/M
3300032047|Ga0315330_10185436Not Available1351Open in IMG/M
3300032257|Ga0316205_10127994All Organisms → Viruses → Predicted Viral1025Open in IMG/M
3300032274|Ga0316203_1020510All Organisms → cellular organisms → Bacteria → Proteobacteria1946Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous22.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater18.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine16.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water5.00%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine5.00%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.00%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water4.00%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine3.00%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat2.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.00%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment2.00%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.00%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.00%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.00%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.00%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.00%
Beach SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006621Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time pointEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300011127Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, 0.02EnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012284Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S2EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019750Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MGEnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022183Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300029309Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032257Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyriteEnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1001452993300000116MarineVIKWLLLMVIAEPNGQINAHVLSAHETMAQCHVAGTYISWEERMPINKEMLCFPTDIDIEVIE*
DelMOSpr2010_1004656423300000116MarineMKWLLLLLVMEADGQITSHVLSAHKTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
DelMOSpr2010_1023957113300000116MarineQMKWLLLLLVMEADGQITSHVLSAHDTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
DelMOWin2010_1005248723300000117MarineMKWLLLLLVMEADGQITSHVLSAQTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
DelMOWin2010_1011378033300000117MarineMKWLLLLLVMEADGQITSHVLSAHDTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
JGI25127J35165_109065023300002482MarineRKQMKWLLLLLIMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
Ga0055584_10008883453300004097Pelagic MarineMQWLLLMIIVSADGSITPHILSQHDTMAGCHVAGTRISWEERMPVNKEMVCLATDIAMRTE*
Ga0055584_10081461443300004097Pelagic MarineMKWLLLMLIMDIDGQITAHILSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMEFEVME
Ga0078893_10660921153300005837Marine Surface WaterMKWLLLMVIASADGEIAVNVLSAHETMAECHVAGTFLTWSERMPVNKEALCFPTEFQFEVME*
Ga0078893_10984379133300005837Marine Surface WaterMKWLLLMIIMDVDGKITSHILSAHDTMAECHVAGTYINWEERMPVNKDMLCFGTDIDMEVME*
Ga0075478_1000017483300006026AqueousMKWLLLMVIMDVDGKITSHILSAHDTMAECHVAGTYINWEERMPVNKDMLCFGTDIDMEVME*
Ga0075478_1016070023300006026AqueousMKWLLLMLMMEADGQITSHILSVHETMAECHVAGTYINWEERMPVNKDMLCFATDINVKVME*
Ga0075462_1000307043300006027AqueousMKWLLLMIIASADGEIAVNVLSAHETMAHCHVAGTKINWEERMPINKEMLCFPTEFQFEVME*
Ga0075462_1001443643300006027AqueousMTWLLLLVVAVDGDISVEVLSRHDTMAGCHVAGTKIHWEERMPVNQEMLCFPTDQEVK*
Ga0075462_1016053823300006027AqueousMKWLLLLLVMEADGQITSHILSAHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME*
Ga0075466_110854723300006029AqueousMKWLLLMVIASGDGEIAVNVLSAHETMAECHVAGTFLTWSERMPVYKEALCFPTEFQFEVME*
Ga0101441_11707223300006621Marine Surface WaterMKWLLLMVIASADGEIAVNVLSAHETMAECHVAGTKINWEERMPINKEMLCFPTEFQFEVME*
Ga0101441_12245283300006621Marine Surface WaterIASADGEIAVNVLSAHETMAECHVAGTFLTWSERMPVNKEALCFPTEFQFEVME*
Ga0098037_117931033300006737MarineMKWLLLMLIMEADGQITSHVLSAHDTMAECHVAGTYIQFEDRLPVNKDMLCF
Ga0098048_102803043300006752MarineMKWLLLMLVMEADGQITSHILSVHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME*
Ga0098048_111561733300006752MarineGARKQMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME*
Ga0098055_134226633300006793MarineMKWLLLLLIMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
Ga0098055_138194313300006793MarineMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFE
Ga0070754_1002246593300006810AqueousMTWLLLLVVAVDGEITVEVLSRHDTMAQCHVGGTRIHWEERLPVNQEMLCFPTDQEVK*
Ga0070754_1039338813300006810AqueousMKWLLLLLIMEADGQITSHVLSAHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME*
Ga0070750_1020728333300006916AqueousRLDGTRKQMKWLLLLLVMEADGQITSHVLSAHDTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
Ga0070750_1035855823300006916AqueousVKWLLLMVIAEVSGELTVHVLSDHDTMAQCHVAGTYINWEERMPVNKEMLCFPTDIEVIR
Ga0070746_1017779813300006919AqueousHWCVRDLDGTRKQMKWLLLLLVMEADGQITSHILSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
Ga0070746_1044652813300006919AqueousMKWLLLMVIASGDGEIAVNVLSAHETMAHCHVAGTKINWEERMPINKEMLCFP
Ga0098045_101907553300006922MarineMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
Ga0098051_100831993300006924MarineMKWLLLMLIMEADGQITSHVLSAHDTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
Ga0070751_132750223300007640AqueousRHGGVRRLDGERNEMKWLLLMVIMDVDGKITSHILSAHDTMAECHVAGTYINWEERMPVNKDMLCFGTDIDMEVME*
Ga0102963_141481723300009001Pond WaterMTWLLLLVVAVDGDISVEVLSRHDTIAGCHVAVTKIHWEERLPVNQEMLCFPTDQEVK*
Ga0118687_1001734833300009124SedimentMAWLLLLVVAVDGDISVEVLSRHDTMAGCHVAGTKIHWEERLPINQEMLCFPTDQEVN*
Ga0118687_1042059513300009124SedimentMTWLLLLVVAVDGDISVEVLSRHDTIAGCHVAGTKIHWEERLPVNQEMLCFPTDQEVK*
Ga0115546_111273423300009435Pelagic MarineMKWLLLLLVMEADGQITSHILSAHETMAECHVAGTYVNWEERMPVNKDMLCFATDMDMEIME*
Ga0098049_115144113300010149MarineDGARKQMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME*
Ga0098056_119664333300010150MarineMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEV
Ga0129348_131601313300010296Freshwater To Marine Saline GradientMEADGQITSHVLSAHDTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
Ga0151665_108463823300011127MarineMKWLLLLVVAIDGDITVNVLSEHETMAGCHVAGTKIHWEERMPINQEMMCFLTAKEVK*
Ga0151671_113975533300011253MarineMKWLLLMLIMEADGQITSHILSVHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME*
Ga0151677_103541973300011258MarineQMKWLLLLLIMEADGQITSHILSVHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME*
Ga0116696_107475323300012284Beach SandLLLLVMEADGQITSHVLSAHDTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME*
Ga0160423_1002578273300012920Surface SeawaterMKWLLLMLVMEADGQITAHVLSDHETMAECHVAGTYINWEERMPVNKDMLCFATDIKIEVME*
Ga0163180_1031330443300012952SeawaterMKWLLLMVVMEADGQITAHVLSDHETMAECHVAGTYINWEERMPVNKDMLCFATDIKIEVME*
Ga0180120_1013909423300017697Freshwater To Marine Saline GradientMKWLLLLLVMEADGQITSHVLSAHKTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Ga0181369_1000171253300017708MarineMKWLLLMLIMEADGQITAHVLSDHETMAECHVAGTYINWEERMPVNKDMLCFATDIKIEVME
Ga0181403_100666043300017710SeawaterMKWLLLLLVMEADGQITSHVLSAHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0181391_100326023300017713SeawaterMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0181391_103353523300017713SeawaterMKWLLLMLVMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Ga0181383_110100723300017720SeawaterMKWLLLMLVMEADGQITSHVLSVHKTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Ga0181381_102667753300017726SeawaterQMKWLLLMVIAEVNGEMTVHVLSDHDTMAGCHVAGTYINWEERMPVNKEMLCFPTDREVI
Ga0181416_105992133300017731SeawaterMKWLLLMLIMEADGKITSHILSVHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0181393_112212413300017748SeawaterQMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Ga0181411_103745643300017755SeawaterMKWLLLLLIMEADGQVTSHILSVHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0181414_103827013300017759SeawaterVRNLDGARKQMKWLLLMLVMEADGQITSHILSVHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0181408_111453613300017760SeawaterRMFRHLCQFGVEGMKWLLLLLIMEADGQITSHVLSAHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0181413_107430513300017765SeawaterMKWLLLMLIMDADGQITAHILSDHETMANCHVAGTYIDWEERMPVNKDMLCFAIDIDMEVME
Ga0187220_110168833300017768SeawaterMKWLLLLLIMEADGQITSHVLSVHKTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Ga0181394_103993043300017776SeawaterMKWLLLLLIMEADGQITSHVLSAHDTMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0181380_100688693300017782SeawaterMKWLLLMLIMEADGQVTSHVLSVHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0181577_1022070143300017951Salt MarshMKWLLLLVVAIDGDITVNVLSGHETMAQCHVAGTKIHWEQRMPINQEMLCFPTDQEVK
Ga0181571_1094020723300017957Salt MarshVNWLLLMVITEVNGGLTVQGLSDHEPMAECHVAGTKIQWEERMPVNKEMLCFATDVKALQ
Ga0181585_1097808723300017969Salt MarshMKWLLLLVVAVDSDITVNVLSGHETMAQCHVAGTKIHWEQRMPINQEMLCFPTDQEVK
Ga0181592_1032635823300018421Salt MarshMKWLLLMVIASADGEIAVSVLSAHETMAHCHVAGTKTNWEKRMPINKEMLCFPTEFQFEVME
Ga0194000_107660423300019750SedimentMKWLLLMIIASADGEIAVSVLSAHETMAHCHVAGTKINWEERMPINKEMLCFPTEFQFEVME
Ga0211532_1038227013300020403MarineLLMLVMEADGQITAHVLSGHETMAECHVAGTYINWEERMPVNKDMLCFATDINVEVME
Ga0211576_1035457313300020438MarineHNAADCFRLNHRRRGHWCVRNLDGARKQMKWLLLLLIMEADGQITSHVLSAHDTMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0211558_1011020243300020439MarineVAGQERRQVTWLLLMVIAEVNGELTVQVLSDHETMAQCHVAGTKIQWEERMHVNKEMLCFATDVKVAQ
Ga0213867_114907223300021335SeawaterMKWLLLLLVMEADGQITSHVLSAHDTMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Ga0213858_1009776933300021356SeawaterMKWLLLLVVAVDGDITVNVLSGHETMAQCHVAGTKIHWEQRMPINQEMLCFPTDQEVK
Ga0213859_1031464523300021364SeawaterMKWLLLVIVAFDGELTVEVISDHETMAQCHVAGTRINWEERMPVNKELLCFATDIEVK
Ga0213859_1036123133300021364SeawaterMKWLLLLVVAIDGDITVNVLSGHETMAQCHVAGTKIHWEQRMPINQEILCFPTDQEVK
Ga0222717_1037061833300021957Estuarine WaterMTWLLLLVVAVDGDISVEVLSRHDTIAGCHVAGTKIHWEERLPINQEMLCFPTDQEVK
Ga0222717_1046221223300021957Estuarine WaterMKWLLLMVIAEVNGEITVHVLSDHDTMAGCHVAGTRTLWEERQANRELLCFPTDIDIEVM
Ga0222718_1000962353300021958Estuarine WaterMTWLLLLVVAVDGDISVEVLSRHDTVAGCHVAGTKIHWEERLPVNQEMLCFPTDQEVK
Ga0222718_1001643333300021958Estuarine WaterMKWLLLLVVAVDGEITVEVLSRHDTMAQCHVGGTRIHWEERLPVNQEMLCFPTDQEVK
Ga0222716_1021041733300021959Estuarine WaterMKWLLLLVVAVDGDITVEVLSRHDTMAQCHVGGTRIHWEERLPVNQEMLCFPTDQEVK
Ga0212024_103055713300022065AqueousMKWLLLMIIASADGEIAVNVLSAHETMAHCHVAGTKINWEERMPINKEMLCFPTEFQFEV
Ga0212021_101222323300022068AqueousMTWLLLLVVAVDGDISVEVLSRHDTMAGCHVAGTKIHWEERMPVNQEMLCFPTDQEVK
Ga0212021_102320933300022068AqueousMKWLLLMIIASADGEIAVNVLSAHETMAHCHVAGTKINWEERMPINKEMLCFPTEFQFEVME
Ga0212021_102726523300022068AqueousMQWLLLMIIVSADGSITPHILSQHDTMAGCHVAGTRISWEERMPVNKEMVCLATDIAMRT
Ga0212026_101933923300022069AqueousMKWLLLMVIMDVDGKITSHILSAHDTMAECHVAGTYINWEERMPVNKDMLCFGTDIDMEVME
Ga0212028_111270323300022071AqueousMTWLLLLVVAVDGEITVEVLSRHDTMAQCHVGGTRIHWEERLPVNQEMLCFPTDQEVK
Ga0224906_100159443300022074SeawaterMKWLLLMVIAEVNGEMTVHVLSDHDTMAGCHVAGTYINWEERMPVNKEMLCFPTDREVIQ
Ga0224906_1005119113300022074SeawaterMKWLLLMLIMEADGQITSHILSVHETMAECHVAGTYINWEERMPVNKDMLCFGTDIDMEVME
Ga0224906_101136573300022074SeawaterMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Ga0224906_107184423300022074SeawaterVTWLLLMVIAEINGELSVQVLSDHKTMAECHVAGTKITWEERMPVNQEMLCFATDIKVTQ
Ga0196891_104544133300022183AqueousDGERNEMKWLLLMVIMDVDGKITSHILSAHDTMAECHVAGTYINWEERMPVNKDMLCFGTDIDMEVME
Ga0208667_104852733300025070MarineQMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0208298_110723513300025084MarineQMKWLLLLLVMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Ga0208434_104077013300025098MarineNLDGARKQMKWLLLLLVMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Ga0208793_100620113300025108MarineMKWLLLMLIMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFAT
Ga0208793_103631653300025108MarineMKWLLLLLIMEADGQITSHVLSAHETMAECHVAGTYINWEERMPVNKDMLCFATDMKFEVME
Ga0208160_115277923300025647AqueousCTTAPPRSRRGGTEMQWLLLMIIVSADGSITPHILSQHDTMAGCHVAGTRISWEERMPVNKEMVCLATDIAMRTE
Ga0208547_102699413300025828AqueousRSRRGGTEMQWLLLMIIVSADGSITPHILSQHDTMAGCHVAGTRISWEERMPVNKEMVCLATDIAMRTE
Ga0183683_1000873103300029309MarineMVIAEVNGEMTVHILSDHETMAQCHVAGTYINWSDRMPVNKEMLCFPTDLDIEVME
Ga0315330_1018543633300032047SeawaterMKWLLLMLVMEADGQITSHILSVHETMAECHVAGTYIQFEDRLPVNKDMLCFGTDIDMEVME
Ga0316205_1012799423300032257Microbial MatVIKWLLLMVIAEPGGQINAHVLSAHETMAQCHVAGTYISWEERMPINKEMLCFPTDIDIEVIE
Ga0316203_102051043300032274Microbial MatVIKWLLLMVIAEPNGQINAHVLSAHETMAQCHVAGTYISWEERMPINKEMLCFPTDIDIEVIE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.