| Basic Information | |
|---|---|
| Taxon OID | 3300025065 Open in IMG/M |
| Scaffold ID | Ga0208015_1002866 Open in IMG/M |
| Source Dataset Name | Marine viral communities from Cariaco Basin, Caribbean Sea - 26B_WHOI_OMZ_CsCl (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4908 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (77.78%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Caribbean Sea: Cariaco Basin | |||||||
| Coordinates | Lat. (o) | 10.847 | Long. (o) | -65.114 | Alt. (m) | Depth (m) | 900 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044014 | Metagenome | 155 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208015_10028666 | F044014 | AGGAG | MPDTGEYKPRFSFEITEEQQQRANKLLATYGLRKAIFGRILEDVLDMIDEFGGVAIGVMMSGKLKPRDVISSMKQAEEVGKK |
| ⦗Top⦘ |