NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208016_103252

Scaffold Ga0208016_103252


Overview

Basic Information
Taxon OID3300025024 Open in IMG/M
Scaffold IDGa0208016_103252 Open in IMG/M
Source Dataset NameMarine viral communities from Cariaco Basin, Caribbean Sea - 28_WHOI_OMZ (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1149
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameCaribbean Sea: Cariaco Basin
CoordinatesLat. (o)10.847Long. (o)-65.114Alt. (m)Depth (m)148
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020384Metagenome / Metatranscriptome224N
F024807Metagenome204N

Sequences

Protein IDFamilyRBSSequence
Ga0208016_1032522F020384N/AMDYKKSKYEISLRKLENILSEVLRSSGNSKQLDLDNRMRRAIRHIQIIKRTAPNNEDGDLAMVKAYQIYDRLQRLSNYPQYFADNTRYAPQRVVSDRFVGYNARPASIRWDAAAMMAVPMAGPDRNWWRPPPRPAPVKHFTQEELENEYPAFTVRKKRKDAT
Ga0208016_1032523F024807GAGGMTKRVMPFNLVYHDRDQQLTLALHDNPVTLTRDEADALAFHLDSFVSDMDSTRKPQPSAEGADIHAEAHGEMLMAQFDDDPNPYHGDYSED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.