Scaffold Ga0209959_100451

Overview

Basic Information

• Taxon OID: 3300024973
• Scaffold ID: Ga0209959_100451
• Source Dataset Name: Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_300_biof (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 30574
• Total Scaffold Genes: 38
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 26 (68.42%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa

Source Dataset Sampling Location

• Location Name: South Africa: Cape Town
• Coordinates
  • Lat. (^o): -33.936637
  • Long. (^o): 18.478905

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033870	Metagenome / Metatranscriptome	176	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209959_10045112	F033870	AGGA	MKVSMEAPQTPQHDLVAMTAALRGVLLQRVEHGIQSSGLTNYFFYLVAKRLTFAGPLTIPGLAEQLRLNPRDIEDSLHVMLERGMVTREDDAWRITDTGRRALTAANNSGEQVLDDIRNAIGAAACDHLVTGMRDALAALRKAA