NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256337_1160543

Scaffold Ga0256337_1160543


Overview

Basic Information
Taxon OID3300024573 Open in IMG/M
Scaffold IDGa0256337_1160543 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)558
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011938Metagenome / Metatranscriptome285Y
F013891Metagenome / Metatranscriptome267Y
F080048Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0256337_11605431F013891N/AKKRVHEIPKPAMLLMDIVKYPDFLALRLYEDNFIQFDGTKKERVIDYVTKVKKLIESYGVRCELEGVPSARVL
Ga0256337_11605432F011938AGGGGGVREYYDIIHIVFIHSENCYGTVEKLGAFASLVKYNIDGYEVEELLENEDFTIVDEIVHQHIEESN
Ga0256337_11605433F080048GAGGMEKILCYSCNKSKNKLDVKKSSLLPINLLMCESCINSKFEPRWVVILAGRSS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.