Scaffold Ga0255056_10108286

Overview

Basic Information

• Taxon OID: 3300024521
• Scaffold ID: Ga0255056_10108286
• Source Dataset Name: Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 1158
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: Northwest Territories
• Coordinates
  • Lat. (^o): 70.66
  • Long. (^o): -123.0
  • Depth (m): 570

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012788	Metagenome / Metatranscriptome	277	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255056_101082865	F012788	N/A	MLNTNITTEIQTTIDELNQYLNGNVTKSSLQITLDELINKL