 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F012788 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 277 |
| Average Sequence Length | 41 residues |
| Representative Sequence | NSKTKIEILSTIDELNQYLNGNVTKTSLQITLDELINKL |
| Number of Associated Samples | 194 |
| Number of Associated Scaffolds | 277 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 13.72 % |
| % of genes from short scaffolds (< 2000 bps) | 84.12 % |
| Associated GOLD sequencing projects | 175 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.895 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (25.993 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.704 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (78.700 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.25.1.0: automated matches | d7diea_ | 7die | 0.85665 |
| f.1.3.1: delta-Endotoxin (insectocide), N-terminal domain | d1w99a1 | 1w99 | 0.84964 |
| a.127.1.0: automated matches | d3c8ta_ | 3c8t | 0.84028 |
| a.24.23.1: Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain | d1szia_ | 1szi | 0.82936 |
| a.127.1.1: L-aspartase/fumarase | d7miwa1 | 7miw | 0.81904 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 277 Family Scaffolds |
|---|---|---|
| PF00118 | Cpn60_TCP1 | 2.17 |
| PF10043 | DUF2279 | 1.08 |
| PF00166 | Cpn10 | 0.72 |
| PF08291 | Peptidase_M15_3 | 0.36 |
| PF13662 | Toprim_4 | 0.36 |
| PF01103 | Omp85 | 0.36 |
| PF13884 | Peptidase_S74 | 0.36 |
| PF12684 | DUF3799 | 0.36 |
| PF03819 | MazG | 0.36 |
| PF00303 | Thymidylat_synt | 0.36 |
| PF11351 | GTA_holin_3TM | 0.36 |
| PF04542 | Sigma70_r2 | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 277 Family Scaffolds |
|---|---|---|---|
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 2.17 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.36 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.36 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.36 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.36 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.90 % |
| All Organisms | root | All Organisms | 23.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.99% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.19% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.30% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.05% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.97% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.61% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.61% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.25% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.53% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.17% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 2.17% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.81% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.81% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.81% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.44% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.44% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.44% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 1.44% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.44% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.08% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.08% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.08% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.72% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.72% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.72% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.72% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.72% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.72% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.72% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.72% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.72% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.36% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.36% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.36% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.36% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.36% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.36% |
| Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 0.36% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.36% |
| Marine Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent | 0.36% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.36% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.36% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.36% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.36% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.36% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.36% |
| Ocean Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2006543006 | Marine microbial communities from anoxic basin of Saanich Inlet - SI040908_100 | Environmental | Open in IMG/M |
| 2100351011 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cm | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300000265 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_10 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001183 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY88 | Host-Associated | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300002153 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Metagenome | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300003878 | Plastic marine debris microbial communities from the Atlantic Ocean - SEA_0142_20120611_metagen | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005820 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2 | Environmental | Open in IMG/M |
| 3300005824 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300008993 | Marine microbial communities from eastern North Pacific Ocean - P1 free-living | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009074 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010330 | Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300011259 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.2 | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300013101 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300019077 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p8 | Environmental | Open in IMG/M |
| 3300019722 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_7-8_MG | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020253 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945) | Environmental | Open in IMG/M |
| 3300020317 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027) | Environmental | Open in IMG/M |
| 3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025684 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
| 3300027159 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes) | Environmental | Open in IMG/M |
| 3300027280 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027791 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300027868 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22 | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031594 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_20m | Environmental | Open in IMG/M |
| 3300031597 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCM | Environmental | Open in IMG/M |
| 3300031622 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_20m | Environmental | Open in IMG/M |
| 3300031700 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_surface | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2007058070 | 2006543006 | Marine | MQNLNSKTRIEILSTIDELNQYLNGFITKTSLQITLDELINKL |
| ASMM170b_04508090 | 2100351011 | Coastal Water And Sediment | MLNTNITTEILTTIDELNQYLNGNVTKTSLQITLDELISKL |
| DelMOSum2010_100910653 | 3300000101 | Marine | MQILNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELKNYLITN* |
| DelMOSum2010_101840522 | 3300000101 | Marine | MQNNIKIEILSTIDELNQYLNGNVTKTSLQITLNELINKL* |
| DelMOSum2011_100436946 | 3300000115 | Marine | MQNLTPTTREEILATIDELNQYLEGNVTKSSLQITLDELINKL* |
| LPaug09P1610mDRAFT_10290642 | 3300000149 | Marine | MQNLTNENKMQILATIDELNQYLNGYVTKTSLQITLNELINKI* |
| TDF_OR_ARG05_123mDRAFT_11179341 | 3300000242 | Marine | MQNLNSKTKIEILSTIDELNQYLNGFVTKSSLQITLDELINKL* |
| LP_A_09_P04_10DRAFT_10273802 | 3300000265 | Marine | MQNLNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDKLINKL* |
| BBAY93_100978202 | 3300000973 | Macroalgal Surface | MQANIKSEILATIDELNQYLNGNITKTSLQITLDELINKL* |
| BBAY88_128789749 | 3300001183 | Macroalgal Surface | MQINSERKELILATIDELNQYLNGYVTTPSLLITLDELYRKL* |
| JGI20160J14292_100958683 | 3300001349 | Pelagic Marine | MNNEIRTEILATIDDLNQYLNGNVTKTGLQITLSELINKL* |
| JGI24540J26637_100204127 | 3300002153 | Marine | MLNTKIKIEILATIDELNQYLNGXVTKTSLQITLDELINKL* |
| JGI24540J26637_101962632 | 3300002153 | Marine | MNNEIRTEILAAIDDLNQYLNGNVTKTGLQITLNELINKL* |
| KVRMV2_1008201852 | 3300002231 | Marine Sediment | MQTKIEILNTIDELNQYLNGNVTTTSLKETLSELITKL* |
| JGI26079J46598_10095003 | 3300003216 | Marine | MNITDETRIEILSTIDELNQYLNGNVTKTSLQITLDELINKL* |
| JGI26260J51721_10280582 | 3300003580 | Marine | MNNEIRTEVLATIDDLNQYLNGNVTKTGLQITLNDLINKL* |
| Ga0063282_10123602 | 3300003878 | Marine | MLNTNITTEIQTTIDELNQYLNGNVTKTSLQITLDELISKL* |
| Ga0065861_10012562 | 3300004448 | Marine | MLNTKIKIEILATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0065861_11508421 | 3300004448 | Marine | METKKLTKEKRIQILATIDELNQYLNGYVTKTSLQITLDELINKI* |
| Ga0073579_109536634 | 3300005239 | Marine | MQINSNTKIEILATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0074648_11879042 | 3300005512 | Saline Water And Sediment | MTNEQRILVIATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0070727_102233242 | 3300005590 | Marine Sediment | MQINSNTKIEILSAIDELNQYLNGNVTKTSLQITLDELISKL* |
| Ga0070724_100817634 | 3300005609 | Marine Sediment | MLNTNITTEIQTTIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0070723_101088572 | 3300005612 | Marine Sediment | MLNTKTKIEILTTIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0070723_103326811 | 3300005612 | Marine Sediment | TMLNTKIKIEILATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0078747_1221483 | 3300005820 | Marine Sediment | MQNLNSKTKIEILATIDELNQYLNGFVTKSSLQITLDELINKL* |
| Ga0074474_15390701 | 3300005824 | Sediment (Intertidal) | MQNLNSKTRIEILSTIDELNQYLNGYTTKSSLQTTLNELINKL* |
| Ga0074476_15603452 | 3300005825 | Sediment (Intertidal) | MQNKRIEILSTIDELNQYLNGNVTKTSLQITLQELIDKL* |
| Ga0075466_11719571 | 3300006029 | Aqueous | MQNLNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELKNKL* |
| Ga0075446_100070981 | 3300006190 | Marine | RVELLATIDEINQYLEGNVTKTGLQITLSELINKL* |
| Ga0075446_100823302 | 3300006190 | Marine | MESSIRIELLATIDEINQYLEGNVTKTGLQITLSELINKL* |
| Ga0075447_101924052 | 3300006191 | Marine | MQLQTTIEIQSTIDELNQYLLGNVTKSSLQITLDELINKL* |
| Ga0099972_118057391 | 3300006467 | Marine | MQINSNTKIEILATIDELNQYLNGNVTKTSLQITLDELISKL* |
| Ga0099972_128805842 | 3300006467 | Marine | MLNTKTKIEIQTTIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0099972_129431151 | 3300006467 | Marine | MQNLNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELINKL* |
| Ga0070744_100016144 | 3300006484 | Estuarine | MTKEIKSEIIATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0098038_10042532 | 3300006735 | Marine | MQITDKTRIEILATIDELNQYLNGNVTKTSLQITLEELINKL* |
| Ga0098035_13169981 | 3300006738 | Marine | MQNLNPKTRAEIIAAIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0098058_10765001 | 3300006750 | Marine | MNNKLKSEIIATIDELNQYLNGNVTKTGLQIALSDLIEKL* |
| Ga0098058_11137132 | 3300006750 | Marine | MQNPTTREEILATIDELNQYLEGNVTKTSLQITLSDLVDKL* |
| Ga0098048_11407742 | 3300006752 | Marine | MQNLNPKTRTEILAAIDELNQYLNGNVTKTSLQITLDELIKKL* |
| Ga0098054_10068985 | 3300006789 | Marine | MQINTNTKFEIIATIDELQQYLNGNVTKTSLQITLDELINKL* |
| Ga0098054_10190421 | 3300006789 | Marine | MQNAEIIAAIDELNQYLEGNVTKTSIQITLSDLINKL* |
| Ga0098054_10247311 | 3300006789 | Marine | MENQTTREQIIATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0098054_11337982 | 3300006789 | Marine | MQNELIIAAIDELNQYLEGNVTKTSLQITLDELINKL* |
| Ga0098054_12316451 | 3300006789 | Marine | MQNELILATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0098054_12643741 | 3300006789 | Marine | MQNIITNEQIIAAIDELNQYLEGNVTKTSLQITLDDLINKL* |
| Ga0098054_12745853 | 3300006789 | Marine | IPMNNVTRIEILATIDELYQYLNGNVTKTSVQITLDELINKL* |
| Ga0098054_13515451 | 3300006789 | Marine | MQNAEIIAAIDELNQYLNGNVTKTSLQITLSDLINKL* |
| Ga0098054_13686931 | 3300006789 | Marine | MDNKLKSEIIATIDELNQYLNGNVTKTGLQIALSDLIEKL* |
| Ga0098055_11433652 | 3300006793 | Marine | ITMQNELILATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0098055_11872201 | 3300006793 | Marine | MPDQITTTREQIIATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0098055_12196421 | 3300006793 | Marine | MQNELILATIDELNQYLEGNVTKTSLQITLDELINKL* |
| Ga0098055_12868152 | 3300006793 | Marine | MPDQITREQIIATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0098055_13044361 | 3300006793 | Marine | MQNIITNEQIIAAIDELNQYLNGNVTKTSLQITLDDLINKL* |
| Ga0075467_104245482 | 3300006803 | Aqueous | MTNEIKSEIIATIDELNQYLNGNVTKTSIQITLDELINKL* |
| Ga0070750_102400522 | 3300006916 | Aqueous | MKPEIKIEILATIDELNQYLNGNVTKTPLQITLDQLINKL* |
| Ga0070746_103514982 | 3300006919 | Aqueous | MKPEIKIEILATIDELNQYLNGNVTKTSLQITLDDLINKL* |
| Ga0070748_13064052 | 3300006920 | Aqueous | MENQTTRDQIIATIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0098045_10983742 | 3300006922 | Marine | MQINSNTKIEILTAIDELNQYINGNVTKTSLQITLDELISKL* |
| Ga0098050_11896142 | 3300006925 | Marine | MQINSNTKIEILTAIDELNQYINGNVTKTSLQITLDEL |
| Ga0075444_101330551 | 3300006947 | Marine | MQVQTKIEIQSTIDELNQYLLGNVTKSSLQITLDELINKL* |
| Ga0070747_10554191 | 3300007276 | Aqueous | MKPEIKIEILATIDELNQYLNGNVTKTSLQITLDQLINKL* |
| Ga0070747_12508861 | 3300007276 | Aqueous | MQSKKIEILATIDELNQYLNGNVTKTSLQITLQELIDKL* |
| Ga0070747_12786121 | 3300007276 | Aqueous | MQLTNELRNEIISTIDELNQYLNGNVTKLGLQVALDELITKLEE* |
| Ga0070752_11410432 | 3300007345 | Aqueous | MQNLNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELKNYLITN* |
| Ga0099851_12257352 | 3300007538 | Aqueous | MQADIKSEIIATIDELNQYLSGNITKTSLQITLDELINKL* |
| Ga0099849_11593881 | 3300007539 | Aqueous | MQNINNNTKIEILATIDELNQYLNGHVTKNSLQITLEELINKL* |
| Ga0099847_11760701 | 3300007540 | Aqueous | MQNTNTREQIIATIDELNQYLEGNVTKSSLQITLDELINKL* |
| Ga0099848_11137551 | 3300007541 | Aqueous | MQLNNNTRIEILSAIDELNQYLNGNVTKTSLQITLDDLINKL* |
| Ga0102818_10154651 | 3300007552 | Estuarine | MQNLNSKTRIEILSTIDELNQYLNGFITKTSLQITLDELINKL* |
| Ga0102901_12314042 | 3300007634 | Estuarine | RIEILSTIDELNQYLNGYTTKSSLQTTLNELINKL* |
| Ga0105746_11138002 | 3300007973 | Estuary Water | MQNLNSKTRIEILSTIDELNQYLNGFVTKSILQITLDELINKL* |
| Ga0105747_10748201 | 3300007974 | Estuary Water | MQNLTPTTREEILATIDELNQYLNGNVTKTSLQITLSDLVNKL* |
| Ga0105747_13230761 | 3300007974 | Estuary Water | MQKLNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELINKL* |
| Ga0098052_12446053 | 3300008050 | Marine | MNNVTRIEILATIDELYQYLNGNVTKTSVQITLDELINKL* |
| Ga0098052_13464931 | 3300008050 | Marine | MQNLNPKTRAEIIATIDELNQYLNGNVTKTSLQITLDELIKK* |
| Ga0115371_103261042 | 3300008470 | Sediment | MQLQTTIEIQSTIDELNQYLLGNVTKSSLQITLDGLINKL* |
| Ga0104258_11138461 | 3300008993 | Ocean Water | IEILSTIDELNQYLNGNVTKTSLQITLQELIDKL* |
| Ga0102816_11719692 | 3300008999 | Estuarine | MHNNIKTEVLSTIDELNQYLNGNVTKTGLQIALNELINKL* |
| Ga0102960_11258672 | 3300009000 | Pond Water | MKITNKNKIEILATIDELNQYLNGNVTKTSLQITLNELINKL* |
| Ga0102829_11016251 | 3300009026 | Estuarine | MQVTKADILAVIDELNQYRNGNVTKTSLQITLSELIDKL* |
| Ga0115549_10852903 | 3300009074 | Pelagic Marine | MTNEQRVEVIATIDELQQYLNGNVTKTSLQITLDELINKL* |
| Ga0115549_12615812 | 3300009074 | Pelagic Marine | MNVTNKLTRVEILATIDELNQYRLGHVTRESLKITLKELLEKLD* |
| Ga0114918_101702883 | 3300009149 | Deep Subsurface | MQINTNTKIEIIATIDELQQYLNGNVTKTSLQITLDELINKL* |
| Ga0114995_100196252 | 3300009172 | Marine | MQNLNSKTKIEILSTIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0114995_1003895311 | 3300009172 | Marine | MKLNNKLQIEILSTIDELNQYLNGNVTKSSLQITLDELINKL* |
| Ga0114995_102365962 | 3300009172 | Marine | MLNTNITTEILTTIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0114995_105111242 | 3300009172 | Marine | MLNTNITTEIQTTIDELNQYLNGNVTKSSLQITLDELINKL* |
| Ga0114994_104506363 | 3300009420 | Marine | MKLNNRLRIEIISTIDELNQYLNGNVTTDSLRDTLEELQNNLSCSDQD* |
| Ga0114998_103014041 | 3300009422 | Marine | MQNLNSKTKTEILSTIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0114998_104962982 | 3300009422 | Marine | MLNTKTKIEILSTIDELNQYLNGNVTKSSLQITLDELINKL* |
| Ga0115005_103498711 | 3300009432 | Marine | MLNTNITTEILTTIDELNQYLNGNVTKSSLQITLDELISKL* |
| Ga0115546_10682784 | 3300009435 | Pelagic Marine | MIENKLTRTEILATIDELNQYLNGNVTKTGLQIALSKLLEKLD* |
| Ga0115546_12561922 | 3300009435 | Pelagic Marine | MQNINNNTKIEILATIDELNQYLNGFVTKSSLQITLDELINKL* |
| Ga0115008_100622896 | 3300009436 | Marine | MTELTNETRINVLATIDELNQYLNGNVTKAGLQFALADLIEKL* |
| Ga0115008_110895662 | 3300009436 | Marine | MNNEIKTEILATIDDLNQYLNGNVTKTGLQITLSELINKL* |
| Ga0115565_104576761 | 3300009467 | Pelagic Marine | MQNLNSKTRIEILSTIDELNQYLNGNVTKSSLQITLDELINKL* |
| Ga0114925_104508391 | 3300009488 | Deep Subsurface | MQLNNNTKLEILTAIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0115004_101409585 | 3300009526 | Marine | MQNRMEILSVIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0115102_100633501 | 3300009606 | Marine | LNSKTRIEILSTIDELNQYLNGFVTKTSLQITLDELINKL* |
| Ga0098049_11361252 | 3300010149 | Marine | MQNLTTREQIIATIDELNQYLEGNVTKTSLQITLDELINKL* |
| Ga0098049_11753172 | 3300010149 | Marine | LKSEIIATIDELNQYLNGNVTKTGLQIALSDLIEKL* |
| Ga0098056_10168091 | 3300010150 | Marine | KIITMQINTNTKFEIIATIDELQQYLNGNVTKTSLQITLDELINKL* |
| Ga0098056_11155851 | 3300010150 | Marine | MQNLNPKTRIEILAAIDELNQYLNGNVTKTSLQITLDELIKKL* |
| Ga0098059_12232821 | 3300010153 | Marine | ITMQNELILATIDELNQYLEGNVTKTSLQITLDELINKL* |
| Ga0098059_12630951 | 3300010153 | Marine | MQNLNPKTRAEIIAAIDELNQYLNGNVTKTSLQITLDELIKKL* |
| Ga0098059_13408692 | 3300010153 | Marine | MQNINATTRIEILAAIDELNQYLNGNVTKTSVQITLDELANKL* |
| Ga0136651_103395292 | 3300010330 | Marine Hydrothermal Vent | MRPEIKYEILAAIDELNQYLNGNVTKTSLQITLSELVDKL* |
| Ga0129324_103192473 | 3300010368 | Freshwater To Marine Saline Gradient | MTNKIKSEIIATIDELNQYLNGNVTKTSIQITLDELINKL* |
| Ga0118731_1067526661 | 3300010392 | Marine | MLNTNITTEIQTTIDELNQYLNGNVTKSSLQITLDELISKL* |
| Ga0118731_1067554563 | 3300010392 | Marine | MLNTKTKIQILSTIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0118731_1105172981 | 3300010392 | Marine | MQLNNNTKIEILATIDELNQYINGNVTKTSLQITLDELISKL* |
| Ga0118733_1082905451 | 3300010430 | Marine Sediment | TKIEILTTIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0133547_119866482 | 3300010883 | Marine | MKTKNLTKEKRIEILATIDELNQYLNGYVTKTSLQITLDELINKI* |
| Ga0114934_101067592 | 3300011013 | Deep Subsurface | MQNINNNTKTEIIATIDELNQYLNGYVTKAGLTVALADLITEINKTW* |
| Ga0114922_104093802 | 3300011118 | Deep Subsurface | MQNINSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELINKL* |
| Ga0114922_107433992 | 3300011118 | Deep Subsurface | MRTEIIATIDELNQYLNGNVTKTSLQITLQELIDKL* |
| Ga0151677_10607752 | 3300011258 | Marine | MNNEIRTEVLATIDDLNQYLNGNVTKTGLQITLSELINKL* |
| Ga0151662_10165834 | 3300011259 | Marine | MQNKKIEILSTIDELNQYLNGNVTKTSLQITLQELIDKL* |
| Ga0163179_110574271 | 3300012953 | Seawater | MQNNIKIEILSTIDELNQYLNGNVTKTSLQITLDELINKL* |
| Ga0164320_100036894 | 3300013098 | Marine Sediment | MQPEIKYEILAAIDELNQYLNGNVTKTSLQITLSELVDKL* |
| Ga0164320_101596612 | 3300013098 | Marine Sediment | MQNINNNTKIEILATIDELNQYLNGNVTKTSLQITLDELINNL* |
| Ga0164313_1001151913 | 3300013101 | Marine Sediment | MRPEIKNEILAAIDELNQYLNGNVTKTSLQITLSELVDKL* |
| Ga0164313_114636272 | 3300013101 | Marine Sediment | MQNINNNTKVEILATIDELNQYLNGNVTKTSLQITLDELINNL* |
| Ga0164321_105280161 | 3300014903 | Marine Sediment | MQNNIKIEILSTIDELNQYLNGYVTKTSLQITLNELINKL* |
| Ga0180120_103133752 | 3300017697 | Freshwater To Marine Saline Gradient | MKPEIKIEILATIDELNQYLNGNVTKTSLQITLDQLINKL |
| Ga0181377_10066204 | 3300017706 | Marine | MPNAEIIAAIDELNQYLNGNVTKTSLQITLSELINKL |
| Ga0181377_10763401 | 3300017706 | Marine | MQNAEILAAIDELNQYLNGNVTKTSLQITLSELINKL |
| Ga0181369_10156734 | 3300017708 | Marine | MIENKLTRTEILATIDELNQYLNGNVTKTGLQIALSKLLEKLD |
| Ga0181387_10563461 | 3300017709 | Seawater | MQNTEIIATIDELNQYLEGNVTKTSLQITLGELINKL |
| Ga0181403_10877901 | 3300017710 | Seawater | MQNPTTREEIIATIDELNQYLEGNVTKSSLQITLDELINKL |
| Ga0181391_10507152 | 3300017713 | Seawater | MQNPTTREEILATIDELNQYLEGNVTKTSLQITLSDLVNKL |
| Ga0181391_10739322 | 3300017713 | Seawater | MQNAEILAAIDELNQYINGNVTKTSLQITLSDLINKL |
| Ga0181412_10574792 | 3300017714 | Seawater | MQNTNTREQIIATIDELNQYLEGNVTKTSLQITLSELINKL |
| Ga0181390_10169736 | 3300017719 | Seawater | MQNTNTRDQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0181390_10679301 | 3300017719 | Seawater | MQNTEIIATIDELNQYLEGNVTKTSLQITLSDLVNKL |
| Ga0181383_10812442 | 3300017720 | Seawater | MQNPTTREEILATIDELNQYLEGNVTKSSLQITLDELINKL |
| Ga0181426_10429374 | 3300017733 | Seawater | NINSKTRIEILAAIDELNQYLNGNVTKTSLQITLSELINKL |
| Ga0181426_11181631 | 3300017733 | Seawater | MQNAEIIATIDELNQYINGNVTKTSLQITLSDLINKL |
| Ga0187218_11524852 | 3300017737 | Seawater | MQDTNTRDQIIATIDELNQYLEGNVTKTSLQITLSELINKL |
| Ga0181418_10812831 | 3300017740 | Seawater | MQNINNNTKIEILATIDELNQYLNGYVTKTSLQITLDELINNL |
| Ga0181389_11647382 | 3300017746 | Seawater | MQNTEIIATIDELNQYLEGNVTKTSLQITLDELINKL |
| Ga0187219_10685021 | 3300017751 | Seawater | MQNPTTREEILATIDELNQYLEGNVTKTALQITLSELINKL |
| Ga0181400_12012611 | 3300017752 | Seawater | ITMQNTNTREQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0181407_10515733 | 3300017753 | Seawater | MNNKLKSEIIATIDELNQYLAGNVTKTGLQIALSDLIEKL |
| Ga0181407_10755133 | 3300017753 | Seawater | MQNTNTREQIIATIDELNQYLNGNVTKTSLQITLDE |
| Ga0181411_12001441 | 3300017755 | Seawater | IITMQDTNTRDQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0181420_11294371 | 3300017757 | Seawater | MENQTTREQIIATIDELNQYLEGNVTKSSLQITLDELINKL |
| Ga0181420_11410131 | 3300017757 | Seawater | MQNLTPTTREEILATIDELNQYLEGNVTKTSLQITLSDLVNKL |
| Ga0181408_10907982 | 3300017760 | Seawater | MQNTNTREQILATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0181422_11983192 | 3300017762 | Seawater | MDNNIKTEVLATIDELNQYLNGNVTKTGLQIALSELINKL |
| Ga0181385_12347901 | 3300017764 | Seawater | MQNTEIIAAIDELNQYLEGNVTKTSLQITLSDLINKL |
| Ga0187221_10906854 | 3300017769 | Seawater | MQNINNNIDIEILATIDELNQYLNGNVTKTSLQITLDELINNL |
| Ga0187217_11617091 | 3300017770 | Seawater | MQNTNKNIKSEILSAIDELNQYLNGNVTKTSLQITLDELINNL |
| Ga0187217_12293792 | 3300017770 | Seawater | MQNAEILAAIDELNQYLEGNVTKTSLQITLSDLINKL |
| Ga0181425_11057991 | 3300017771 | Seawater | MQNPTTREEILATIDELNEYLEGNVTKSSLQITLSDLVNKL |
| Ga0181395_10504505 | 3300017779 | Seawater | MNKLIKTEVLATIDELNQYLNGNVTKTSLQITLDDLINKL |
| Ga0181423_13354881 | 3300017781 | Seawater | TMQNTNTRDQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0181424_103946171 | 3300017786 | Seawater | MQNPTTREQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0181552_102038662 | 3300017824 | Salt Marsh | MQADIKSEIIATIDELNQYLSGNITKTSLQITLDELINKL |
| Ga0181580_100921203 | 3300017956 | Salt Marsh | MQEIKTEILATIDDLNQYLNGNVTKDGLKETLKTLISKL |
| Ga0181592_110099621 | 3300018421 | Salt Marsh | MQEIKTEIIATIDDLNQYLNGNITKDGLKETLKTLISKL |
| Ga0188848_10131213 | 3300018775 | Freshwater Lake | MQANIKSEILAAIDELNQYLNGNITKTSLQITLDELINKL |
| Ga0188868_10007182 | 3300019077 | Freshwater Lake | MQINSNTKIEILTAIDELNQYLNGNVTKTSLQITLDELISKL |
| Ga0193971_10369621 | 3300019722 | Sediment | ITMQILNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELKNYLITN |
| Ga0206125_100990132 | 3300020165 | Seawater | MDNKLKSEIIATIDELNQYLNGNVTKTGLQIALSDLIEKL |
| Ga0206125_101656132 | 3300020165 | Seawater | MQSEIKTEVLATIDELNQYLNGNVTKSGLQIALSELIDKL |
| Ga0206125_103824111 | 3300020165 | Seawater | MQSEIKTEVLATIDELNQYLNGNVTKTGLQIALSELIDKL |
| Ga0206129_100775514 | 3300020182 | Seawater | MQNLNSKNRIEILSTIDELNQYLNGFVTKSSLQITLDELINKL |
| Ga0211685_10579672 | 3300020253 | Marine | MQVQTKIEIQSTIDELNQYLLGNVTKSSLQITLDELINKL |
| Ga0211688_10239333 | 3300020317 | Marine | MQNLTIDNRIQILSTIDELNQYLNGYVTKTSLQITLNELINKIE |
| Ga0211539_104185861 | 3300020437 | Marine | MQNKTEIIAAIDELNQYLNGNVTKGSLQITLSELITKLYTN |
| Ga0211558_103027762 | 3300020439 | Marine | MRTELIATIDELNQYLNGNVTKKSLIRTLYRLISLLVYTDFKTK |
| Ga0206678_100238953 | 3300021084 | Seawater | MENQTTREQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0206677_100042378 | 3300021085 | Seawater | MQNAEIIAAIDELNQYLEGNVTKTSIQITLSDLINKL |
| Ga0206677_1001078310 | 3300021085 | Seawater | MQNLTPTTREEIIATIDELNQYLEGNVTKTSLQITLSDLVNKL |
| Ga0206677_100226257 | 3300021085 | Seawater | MQDTNTRDQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0206677_102346141 | 3300021085 | Seawater | MQNPTTREEILATIDELNQYLEGNVTKTSLQITLDELINKL |
| Ga0206677_103752572 | 3300021085 | Seawater | MQNLNSKTRIEILSTIDELNQYLNGFVTKTSLQITLDELINKL |
| Ga0206683_106259261 | 3300021087 | Seawater | ENQTTREQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0206682_100199421 | 3300021185 | Seawater | MQDTNTREQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0206682_102004691 | 3300021185 | Seawater | MQNTEIIATIDELNQYLEGNVTKTSLQITLSELINKL |
| Ga0213862_100998703 | 3300021347 | Seawater | MQNLNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELINKL |
| Ga0213865_100035161 | 3300021373 | Seawater | MQINSERKELIIATIDELNQYLLGNVTTASLLITLDELYREL |
| Ga0213869_103171622 | 3300021375 | Seawater | MQNNIKIEILSTIDELNQYLNGNVTKTSLQITLNELINKL |
| Ga0213861_102011001 | 3300021378 | Seawater | MQNLTPTTREEILATIDELNQYLNGNVTKTSLQITLSDLVNKL |
| Ga0222717_102374952 | 3300021957 | Estuarine Water | MNNEIRTEVLATIDDLNQYLNGNVTKTGLQITLSELINKL |
| Ga0222717_104108842 | 3300021957 | Estuarine Water | MQNPTTREEILATIDELNQYLEGNVTKSSLQITLSDLVNKL |
| Ga0222717_105515051 | 3300021957 | Estuarine Water | MQNAEIIAAIDELNQYLNGNVTKTSLQITLSDLINKL |
| Ga0222717_105912371 | 3300021957 | Estuarine Water | MQNLTPTTREEILATIDELNQYLEGNVTKSSLQITLSDLVNKL |
| Ga0222717_105985501 | 3300021957 | Estuarine Water | MQNKRIEILATIDELNQYLNGNVTKTSLQITLQELIDKL |
| Ga0222717_107054032 | 3300021957 | Estuarine Water | TTREEILATIDELNQYLEGNVTKSSLQITLDELINKL |
| Ga0222718_100368391 | 3300021958 | Estuarine Water | MQLNNNTKIEILSAIDELNQYLNGNVTKTSLQITLDDLINKL |
| Ga0222718_103574812 | 3300021958 | Estuarine Water | MKLEIKTEILATIDELNQYLNGNVTKTSLQITLDDLINKL |
| Ga0222716_100129722 | 3300021959 | Estuarine Water | MQINSNTKIEILTAIDELNQYINGNVTKTSLQITLDELISKL |
| Ga0222716_100437717 | 3300021959 | Estuarine Water | MQNAEIIATIDELNQYLNGNVTKTSLQITLSDLINKL |
| Ga0222715_100979561 | 3300021960 | Estuarine Water | MQNPTTREEILATIDELNQYLEGNVTKSSLQITLSDLINKL |
| Ga0222715_104378022 | 3300021960 | Estuarine Water | MQINSNTKIEILTAIDELQQYLNGNVTKTSLQITLDELISKL |
| Ga0222715_104489061 | 3300021960 | Estuarine Water | MQNLTPTTREEILATIDELNQYLNGNVTKSSLQITLDELINKL |
| Ga0222715_106805331 | 3300021960 | Estuarine Water | MQNLTTREEIIATIDELNQYLEGNVTKSSLQITLDELIN |
| Ga0212030_10331641 | 3300022053 | Aqueous | MQNLNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELKNKL |
| Ga0212023_10194262 | 3300022061 | Aqueous | MQILNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELKNYLITN |
| Ga0212023_10330713 | 3300022061 | Aqueous | MTNEIKSEIIATIDELNQYLNGNVTKTSIQITLDELINKL |
| Ga0196889_10187882 | 3300022072 | Aqueous | MENKKIEILSTIDELNQYLNGNVTKNSLKTTLQELIDKL |
| Ga0196905_10029371 | 3300022198 | Aqueous | NTRIEILSAIDELNQYLNGNVTKTSLQITLDDLINKL |
| Ga0196901_11705321 | 3300022200 | Aqueous | MQINTNTKIEIIATIDELQQYLNGNVTKTSLQITLAELIDKL |
| Ga0224509_103395041 | 3300022306 | Sediment | TREEILATIDELNQYLEGNVTKSSLQITLSDLINKL |
| Ga0255783_102399791 | 3300022923 | Salt Marsh | ADIKSEIIATIDELNQYLSGNITKTSLQITLDELINKL |
| (restricted) Ga0233432_105001361 | 3300023109 | Seawater | MQINSNTKIEILATIDELNQYLNGNVTKTSMQITLDELINKL |
| (restricted) Ga0255039_104035631 | 3300024062 | Seawater | MPKLTNKTRINVLATIDELNQYLNGNVTKTGLQIALSDLIEKL |
| Ga0244775_100017729 | 3300024346 | Estuarine | MTKEIKSEIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0209977_103281961 | 3300024432 | Deep Subsurface | KPNVITMQLNNETKIEILTAIDELNQYLNGNVTKTSLQITLDDLINKL |
| Ga0209986_105227672 | 3300024433 | Deep Subsurface | MQLNNNTRIEILSAIDELNQYLNGNVTKTSLQITLDDLINKL |
| (restricted) Ga0255056_101082865 | 3300024521 | Seawater | MLNTNITTEIQTTIDELNQYLNGNVTKSSLQITLDELINKL |
| (restricted) Ga0255056_101337772 | 3300024521 | Seawater | MLNTNITTEIQTTIDELNQYLNGNVTKTSLQITLDELINKL |
| (restricted) Ga0255056_102934251 | 3300024521 | Seawater | MSKLNSNTKSEILSVIDELNQYLNGNVTKTSLQISLDELINKI |
| (restricted) Ga0255056_104244411 | 3300024521 | Seawater | MQNLNSKTKIEILSTIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0207905_10374193 | 3300025048 | Marine | MLNTNITTEIQTTIDELNQYLNGNVTKSSLQITLDELISKL |
| Ga0208667_10031645 | 3300025070 | Marine | MQINTNTKFEIIATIDELQQYLNGNVTKTSLQITLDELINKL |
| Ga0208791_10814181 | 3300025083 | Marine | MQNPTTREEILATIDELNQYLEGNVTKTSLQITLSDLVDKL |
| Ga0208298_100076119 | 3300025084 | Marine | MQNAEILAAIDELNQYLNGNVTKTSLQITLSDLINKL |
| Ga0208792_10156544 | 3300025085 | Marine | MNNKLKSEIIATIDELNQYLNGNVTKTGLQIALSDLIEKL |
| Ga0208792_10421871 | 3300025085 | Marine | MQNELILATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0208157_10005577 | 3300025086 | Marine | MQITDKTRIEILATIDELNQYLNGNVTKTSLQITLEELINKL |
| Ga0208669_11297151 | 3300025099 | Marine | MPDQITTTREQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0208013_11119241 | 3300025103 | Marine | MQNLNPKTRIEILAAIDELNQYLNGNVTKTSLQITLDELIKKL |
| Ga0208793_11055501 | 3300025108 | Marine | MQNELIIAAIDELNQYLEGNVTKTSLQITLDELINKL |
| Ga0208793_11633981 | 3300025108 | Marine | MPDQITREQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0209535_100100435 | 3300025120 | Marine | MQNKKIEILSTIDELNQYLNGNVTKTSLQITLQELIDKL |
| Ga0209535_10264995 | 3300025120 | Marine | MQNLTNENKMQILATIDELNQYLNGYVTKTSLQITLNELINKI |
| Ga0209535_11577702 | 3300025120 | Marine | MHNNIKTEVLATIDELNQYLNGNVTKTSLQIALSELIDKL |
| Ga0209535_11933621 | 3300025120 | Marine | MQNLNSKTRIEILSTIDELNQYLNGFVTKSSLQITLAELINKL |
| Ga0209557_10703121 | 3300025483 | Marine | MNNEIRTEVLATIDDLNQYLNGNVTKTGLQITLNDLINKL |
| Ga0208303_10258203 | 3300025543 | Aqueous | MQNTNTREQIIATIDELNQYLEGNVTKSSLQITLDELINKL |
| Ga0208303_10604441 | 3300025543 | Aqueous | MQNLNSKTRIEILSTIDELNQYLNGFVTKSSLQITLDELKNYLITN |
| Ga0208303_10842332 | 3300025543 | Aqueous | MNNEIRTEILATIDDLNQYLNGNVTKTGLQITLSE |
| Ga0208303_11290741 | 3300025543 | Aqueous | MQVTKADILAVIDELNQYRNGNVTKTSLQITLSELIDKL |
| Ga0209094_10883891 | 3300025594 | Pelagic Marine | MTNEQRVEVIATIDELQQYLNGNVTKTSLQITLDELINKL |
| Ga0209094_11424542 | 3300025594 | Pelagic Marine | MNVTNKLTRVEILATIDELNQYRLGHVTRESLKITLKELLEKLD |
| Ga0209716_100180337 | 3300025626 | Pelagic Marine | MNNEIRTEILATIDDLNQYLNGNVTKTGLQITLSELINKL |
| Ga0209716_10645612 | 3300025626 | Pelagic Marine | MQNLNSKTKIEILATIDELNQYLNGFVTKSSLQITLDELINKL |
| Ga0209136_100166521 | 3300025636 | Marine | MNITDETRIEILSTIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0209136_10353173 | 3300025636 | Marine | MTNEQRILVIATIDELNQYLNGYVTKTSLQITLDELINKL |
| Ga0209652_10506423 | 3300025684 | Marine | MTNEQRIEIIATIDELQQYLNGNVTKTSLQITLNELINKL |
| Ga0209653_10727682 | 3300025695 | Marine | MTNEQRIEVIAAIDELQQYLNGYVTKTSIQITLDELINKL |
| Ga0209715_12570992 | 3300025699 | Pelagic Marine | MNNEIRTEVLATIDDLNQYLNGNVTKTGLQITLNELINKL |
| Ga0209757_102993971 | 3300025873 | Marine | MRPEIKYEILAAIDELNQYLNGNVTKTSLQITLSELVDKL |
| Ga0228622_11209511 | 3300026479 | Seawater | MQLEIKNEILATIDELNQYLNGNVTKTSLQITLSELVDKL |
| Ga0208020_10056514 | 3300027159 | Estuarine | MQNKRIEILSTIDELNQYLNGNVTKTSLQITLQELIDKL |
| Ga0208972_10282941 | 3300027280 | Marine | TRIEILSTIDELNQYLNGYTTKSSLQTTLNELINKL |
| Ga0209384_10671772 | 3300027522 | Marine | MESSIRIELLATIDEINQYLEGNVTKTGLQITLSELINKL |
| Ga0209192_100469564 | 3300027752 | Marine | MLNTNITTEILTTIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0209192_101010431 | 3300027752 | Marine | MQNRMEILSVIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0209192_103702372 | 3300027752 | Marine | MKLNNKLQIEILSTIDELNQYLNGNVTKSSLQITLDELINKL |
| Ga0209379_100266694 | 3300027758 | Marine Sediment | MLNTNITTEIQTTIDELNQYLNGNVTKTSLQITLDELISKL |
| Ga0209830_103903751 | 3300027791 | Marine | NSKTKIEILSTIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0209712_101003956 | 3300027849 | Marine | MLNTNITTEILTTIDELNQYLNGNVTKSSLQITLDELISKL |
| (restricted) Ga0255052_104662992 | 3300027865 | Seawater | SKTRIEILSTIDELNQYLNGFVTKSSLQITLDELINKL |
| (restricted) Ga0255053_105254791 | 3300027868 | Seawater | INLITMQNLNSKTKIQILSTIDELNQYLNGNVTKTSLQITLDELINKL |
| (restricted) Ga0255055_103860661 | 3300027881 | Seawater | MQNLNSKTKIQVLSTIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0256368_10159001 | 3300028125 | Sea-Ice Brine | MQNSTPITREEILATIDELNQYLNGNVTKSSLQITLSELINKL |
| Ga0265303_116854452 | 3300028600 | Sediment | NRIEILSTIDELNQYLNGFVTKSSLQITLDELINKL |
| Ga0183755_10234378 | 3300029448 | Marine | MQSNFIRTEILATIDELNQYLLGNVTKSSLQVTLEELINNL |
| Ga0307380_106409491 | 3300031539 | Soil | MQINTNTKIEIIATIDELQQYLNGNVTKTSLQITLDELINKL |
| Ga0307379_106576573 | 3300031565 | Soil | TRIEILSTIDELNQYLNGFVTKSSLQITLEELINKL |
| Ga0307379_113453641 | 3300031565 | Soil | MQINTNTKIEIIATIDELQQYLNGNVTKTSLQITLDEL |
| Ga0307378_101815681 | 3300031566 | Soil | MQINTNTKIEIIATIDELQQYLNGNVTKTSLQITLDELMNKL |
| Ga0302131_10147141 | 3300031594 | Marine | MLNTKTKIEILTTIDELNQYLNGNVTKSSLQITLDELISKL |
| Ga0302116_11217531 | 3300031597 | Marine | TTEIQTTIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0302126_101258191 | 3300031622 | Marine | MLNTKTKIEILSTIDELNQYLNGNVTKSSLQITLDELINKL |
| Ga0302130_12421243 | 3300031700 | Marine | AYTNLITMLNTNITTEIQTTIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0315322_100578627 | 3300031766 | Seawater | MQNTNTREQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0316208_10488442 | 3300032254 | Microbial Mat | MENQTTRDQIIATIDELNQYLNGNVTKTSLQITLDELINKL |
| Ga0316208_11404961 | 3300032254 | Microbial Mat | MQNLTTREEIIATIDELNQYLEGNVTKTSLQITLDELINKL |
| Ga0316202_105480951 | 3300032277 | Microbial Mat | MQLNNNTKIEILATIDELNQYINGNVTKTSLQITLDELISKL |
| Ga0314858_112576_325_456 | 3300033742 | Sea-Ice Brine | MQNLNSKTKIQILSTIDELNQYLNGNVTKTSLQIALDELINKL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |