Basic Information | |
---|---|
Taxon OID | 3300024269 Open in IMG/M |
Scaffold ID | Ga0257076_10177941 Open in IMG/M |
Source Dataset Name | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? diluted pellet 2 Spades (v3) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2658 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 34.4204 | Long. (o) | -119.6671 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F076673 | Metagenome | 117 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0257076_101779411 | F076673 | N/A | SVCRNISGKLPSHAFAALTGLCGVPPHELLASFSVLQKSE |
⦗Top⦘ |