| Basic Information | |
|---|---|
| Taxon OID | 3300024253 Open in IMG/M |
| Scaffold ID | Ga0261704_153023 Open in IMG/M |
| Source Dataset Name | Lab enriched microbial communities from a contaminated site in Ontario, Canada - KB1TCB_rich_medium |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Toronto |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 140276 |
| Total Scaffold Genes | 119 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 15 (12.61%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Laboratory Enrichment Culture → Metagenomes From 1,2,4-Trichlorobenzene Dechlorinating Enrichment Cultures |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Toronto, Ontario | |||||||
| Coordinates | Lat. (o) | 43.65699737 | Long. (o) | 79.39033177 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088079 | Metagenome / Metatranscriptome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0261704_1530232 | F088079 | N/A | MLTEKAIWLENVPFRSIDGAIGRQNCSVYFVESMFVGQSCTFCTSILGYLAPNPYRMLTRLGIFVHICEIYKADITFFKPNVISTK |
| ⦗Top⦘ |