Scaffold Ga0261704_139916

Overview

Basic Information

• Taxon OID: 3300024253
• Scaffold ID: Ga0261704_139916
• Source Dataset Name: Lab enriched microbial communities from a contaminated site in Ontario, Canada - KB1TCB_rich_medium
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 72462
• Total Scaffold Genes: 58
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (20.69%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Laboratory Enrichment Culture → Metagenomes From 1,2,4-Trichlorobenzene Dechlorinating Enrichment Cultures

Source Dataset Sampling Location

• Location Name: Toronto, Ontario
• Coordinates
  • Lat. (^o): 43.65699737
  • Long. (^o): 79.39033177

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088079	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0261704_1399167	F088079	N/A	MLTEKAIWLENVPFRSIDGAIGGQNCSVYFVESMIVGQSCTFCTSRLGNLAPNPYRMLTRLDVFIHICEIYKADITFFKSNVVSTK