NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228673_1037054

Scaffold Ga0228673_1037054


Overview

Basic Information
Taxon OID3300024242 Open in IMG/M
Scaffold IDGa0228673_1037054 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 91D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)864
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044514Metagenome / Metatranscriptome154N
F092096Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0228673_10370541F092096N/ANVEGPSIVVNIPEQQVKEKVIIKEVKVPVKKKKEKEQEIDW
Ga0228673_10370542F044514N/AMSSFKKWWKVNGQGIGFIAGIVFLNAYFLILCDLMNKHEWLAGVWLLCFFGFAGWYSWQMKIHGWRLPKDIKDTH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.