Scaffold Ga0228598_1000060

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0228598_1000060

Scaffold Ga0228598_1000060

Overview

Basic Information
Taxon OID	3300024227 Open in IMG/M
Scaffold ID	Ga0228598_1000060 Open in IMG/M
Source Dataset Name	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15974
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	22 (95.65%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location Name	Czech Republic: South Bohemian Region
Coordinates	Lat. (^o)	49.0427	Long. (^o)	13.6161	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087521	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0228598_10000601	F087521	GGAGG	MYTYLCCRCTKCTARIVLEEWAESMYLLHRPVRARPRYQKCPFCDSAFAPDRYYVTESGAPLAVSGRTVEMRDSFALVEQDNVRTSKSS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.