Basic Information | |
---|---|
Taxon OID | 3300024186 Open in IMG/M |
Scaffold ID | Ga0247688_1047793 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 684 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Indiana | |||||||
Coordinates | Lat. (o) | 40.4449 | Long. (o) | -87.0297 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087696 | Metagenome / Metatranscriptome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247688_10477932 | F087696 | N/A | KFQPDGKKIEGPAPRPLPHYSIILTADGELLVDKLQTIKADQVLKV |
⦗Top⦘ |