Basic Information | |
---|---|
Family ID | F087696 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 40 residues |
Representative Sequence | GVKIEGPAPRPLPHFAISLTADGELLVDKLQIIKPSQVLKV |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 88.18 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.182 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.818 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.182 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 18.84% Coil/Unstructured: 76.81% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF00033 | Cytochrome_B | 76.36 |
PF14358 | DUF4405 | 9.09 |
PF00034 | Cytochrom_C | 3.64 |
PF00032 | Cytochrom_B_C | 2.73 |
PF07732 | Cu-oxidase_3 | 2.73 |
PF02433 | FixO | 1.82 |
PF14522 | Cytochrome_C7 | 0.91 |
PF13631 | Cytochrom_B_N_2 | 0.91 |
PF13442 | Cytochrome_CBB3 | 0.91 |
COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
---|---|---|---|
COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 79.09 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 2.73 |
COG2993 | Cbb3-type cytochrome oxidase, cytochrome c subunit FixO | Energy production and conversion [C] | 1.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.18 % |
Unclassified | root | N/A | 1.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004152|Ga0062386_100807458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 773 | Open in IMG/M |
3300004268|Ga0066398_10075245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 738 | Open in IMG/M |
3300004609|Ga0068958_1336557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
3300005435|Ga0070714_101338190 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300005436|Ga0070713_101817663 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005446|Ga0066686_10441914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 888 | Open in IMG/M |
3300005542|Ga0070732_10026001 | All Organisms → cellular organisms → Bacteria | 3317 | Open in IMG/M |
3300005559|Ga0066700_10008311 | All Organisms → cellular organisms → Bacteria | 5235 | Open in IMG/M |
3300005568|Ga0066703_10007219 | All Organisms → cellular organisms → Bacteria | 5114 | Open in IMG/M |
3300006050|Ga0075028_100191332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1101 | Open in IMG/M |
3300006172|Ga0075018_10429337 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300006173|Ga0070716_100520797 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300006755|Ga0079222_10082240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1628 | Open in IMG/M |
3300009012|Ga0066710_101657787 | Not Available | 976 | Open in IMG/M |
3300009038|Ga0099829_10089803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2370 | Open in IMG/M |
3300009088|Ga0099830_10667073 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300009089|Ga0099828_10689168 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
3300009090|Ga0099827_10010506 | All Organisms → cellular organisms → Bacteria | 5958 | Open in IMG/M |
3300009824|Ga0116219_10621428 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300009824|Ga0116219_10793207 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300010048|Ga0126373_12466960 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300010336|Ga0134071_10784729 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300010336|Ga0134071_10809077 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300010358|Ga0126370_10332742 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
3300010360|Ga0126372_10367693 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
3300010360|Ga0126372_12651510 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300010361|Ga0126378_10915061 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300010376|Ga0126381_101939060 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300010376|Ga0126381_102008539 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300011089|Ga0138573_1221318 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300011271|Ga0137393_11516073 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300012189|Ga0137388_10598846 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300012201|Ga0137365_10735492 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300012207|Ga0137381_10129786 | All Organisms → cellular organisms → Bacteria | 2158 | Open in IMG/M |
3300012207|Ga0137381_11158318 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300012210|Ga0137378_10287874 | Not Available | 1528 | Open in IMG/M |
3300012210|Ga0137378_11792022 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300012357|Ga0137384_10082372 | All Organisms → cellular organisms → Bacteria | 2674 | Open in IMG/M |
3300012357|Ga0137384_10693708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
3300012917|Ga0137395_10900384 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300012971|Ga0126369_10592572 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
3300012971|Ga0126369_12508894 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300012975|Ga0134110_10021638 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
3300014058|Ga0120149_1115012 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300016270|Ga0182036_10455954 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
3300016270|Ga0182036_11286988 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300016341|Ga0182035_11707474 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300016422|Ga0182039_10336481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1263 | Open in IMG/M |
3300016422|Ga0182039_11774399 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300017929|Ga0187849_1091000 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300017931|Ga0187877_1403691 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300017940|Ga0187853_10354913 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300017955|Ga0187817_10225222 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300017955|Ga0187817_10366019 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300017973|Ga0187780_11046607 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300017995|Ga0187816_10008227 | All Organisms → cellular organisms → Bacteria | 3774 | Open in IMG/M |
3300017995|Ga0187816_10051199 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
3300018057|Ga0187858_10518622 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300018062|Ga0187784_11679929 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300018085|Ga0187772_11324733 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300018086|Ga0187769_10976535 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300018090|Ga0187770_10793126 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300018090|Ga0187770_11695532 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300020580|Ga0210403_10429653 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300024186|Ga0247688_1047793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 684 | Open in IMG/M |
3300024222|Ga0247691_1061802 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300024245|Ga0247677_1062196 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300025498|Ga0208819_1005537 | All Organisms → cellular organisms → Bacteria | 4758 | Open in IMG/M |
3300026326|Ga0209801_1172487 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300026551|Ga0209648_10319059 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300026871|Ga0207825_106111 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300027703|Ga0207862_1115888 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300027748|Ga0209689_1099888 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
3300027787|Ga0209074_10031317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1521 | Open in IMG/M |
3300027857|Ga0209166_10195212 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300027867|Ga0209167_10315375 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300027875|Ga0209283_10430711 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300027882|Ga0209590_10378136 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300030659|Ga0316363_10113471 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300031090|Ga0265760_10008574 | All Organisms → cellular organisms → Bacteria | 2921 | Open in IMG/M |
3300031128|Ga0170823_13910047 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300031231|Ga0170824_113589278 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300031573|Ga0310915_11209975 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300031668|Ga0318542_10021083 | All Organisms → cellular organisms → Bacteria | 2680 | Open in IMG/M |
3300031680|Ga0318574_10165014 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
3300031682|Ga0318560_10060108 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
3300031744|Ga0306918_11174414 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300031747|Ga0318502_10297413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 949 | Open in IMG/M |
3300031765|Ga0318554_10601151 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300031782|Ga0318552_10475684 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300031792|Ga0318529_10543138 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300031793|Ga0318548_10188878 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300031879|Ga0306919_11134555 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300031890|Ga0306925_10803541 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300031890|Ga0306925_12075317 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300031910|Ga0306923_10920209 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300031912|Ga0306921_10752356 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300031941|Ga0310912_10668335 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
3300031945|Ga0310913_10271537 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
3300031945|Ga0310913_10938016 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300031946|Ga0310910_11389437 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300031947|Ga0310909_10533457 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
3300032035|Ga0310911_10427527 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300032051|Ga0318532_10296062 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300032059|Ga0318533_10109942 | All Organisms → cellular organisms → Bacteria | 1918 | Open in IMG/M |
3300032059|Ga0318533_11360914 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300032091|Ga0318577_10271063 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300032180|Ga0307471_101177833 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300033290|Ga0318519_10031102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2520 | Open in IMG/M |
3300033804|Ga0314863_128152 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.18% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.45% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.64% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.64% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.73% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.73% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.73% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.82% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.82% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.91% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.91% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004609 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026871 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 78 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062386_1008074581 | 3300004152 | Bog Forest Soil | EGKKLEGPAPRPLPHYSISLTADGELIVDKLQVIKADQVLRV* |
Ga0066398_100752452 | 3300004268 | Tropical Forest Soil | GKKIEGPAPRPLPHYSITLTADGELLVDKLQIVKSEQVLKV* |
Ga0068958_13365571 | 3300004609 | Peatlands Soil | DGTKIEGPAPRPLPHFSILLTPDGELQVDKLETISANQVLRA* |
Ga0070714_1013381901 | 3300005435 | Agricultural Soil | SDGTKIEGPAPRPLPHFGISLTADGELLVDKLQNIKSQQVLKV* |
Ga0070713_1018176631 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TKIEGPAPRPLPHFAISLTADGELLVDKLQNIKSEQVLKA* |
Ga0066686_104419141 | 3300005446 | Soil | VKIEGPAPRPLPHFAISLTADGELVVDKLQIIKASQVLKV* |
Ga0070732_100260011 | 3300005542 | Surface Soil | EDGTKVAGPAPRPLPHFAISLTSDGDLLVDKLQNIKPTQVLKV* |
Ga0066700_100083111 | 3300005559 | Soil | DGVKIEGPAPRPLPHFAISLAADGELVVDKLQIIKASQVLKV* |
Ga0066703_100072196 | 3300005568 | Soil | SDGTKVEGPAPRPLPHFAISLTSDGELLVDKLQEIKSEQVLKV* |
Ga0075028_1001913321 | 3300006050 | Watersheds | PAPRPLPHFAISLTADGELLVDKLQNLKTTQVLKV* |
Ga0075018_104293372 | 3300006172 | Watersheds | KFRDDGSKVEGPAPRPLPHFAVSLTADGELLVDKLQNIKPAQVLKV* |
Ga0070716_1005207972 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | APRPLPHFAISLTADGELLVDKLQTIKSAQVLKV* |
Ga0079222_100822403 | 3300006755 | Agricultural Soil | KSDGTKIEGPAPRPLPHFAISLTADGELQVDKLEVISPGQALKA* |
Ga0066710_1016577872 | 3300009012 | Grasslands Soil | KSDGSKIEGPAPRPLPHFAISLTADGELLVDKLQSIKPAQVLRV |
Ga0099829_100898031 | 3300009038 | Vadose Zone Soil | GPAPRPLPHFAISLTADGELLVDKLQYIKSAEVLKV* |
Ga0099830_106670731 | 3300009088 | Vadose Zone Soil | APRSLPHFAITLTPDGELLVDKMETIKSEQALKV* |
Ga0099828_106891682 | 3300009089 | Vadose Zone Soil | FRADGTKIEGPAPRSLPHFSITLTADGELRVDKLEAVKPSQALKV* |
Ga0099827_100105061 | 3300009090 | Vadose Zone Soil | KIEGPAPRALPHFAISLTADGELLVDKLQNIKPAQVLKV* |
Ga0116219_106214282 | 3300009824 | Peatlands Soil | FEPNGKKIEGPAPRPPPHFSVTLTADGELLVDKLQVIKPDQVLNV* |
Ga0116219_107932072 | 3300009824 | Peatlands Soil | PNGKKIEGPAPRPLPHFSVALTADGELLVDKLQVIKADQVLKV* |
Ga0126373_124669601 | 3300010048 | Tropical Forest Soil | APRPLPHFAITLTADGELQVDKLQVIKPSQVLKV* |
Ga0134071_107847292 | 3300010336 | Grasslands Soil | AKVEGPAPRSLPHFAITLTPDGELLVDKLEVIKAGQALRV* |
Ga0134071_108090771 | 3300010336 | Grasslands Soil | GPAPRPLPHFAITLTAEGELMVDKLEVVKPSQILKV* |
Ga0126370_103327423 | 3300010358 | Tropical Forest Soil | EGPAPRPLPHFAISLTADGELLVDKLQIIKPSQVLRV* |
Ga0126372_103676931 | 3300010360 | Tropical Forest Soil | EGTKIEGPAPRPLPHFAISLTADGELLVDKLQIIKPSQVLKV* |
Ga0126372_126515102 | 3300010360 | Tropical Forest Soil | GIKIEGPAPRPLPHFGISLTADGELLVDKLQSVKNTQALKT* |
Ga0126378_109150611 | 3300010361 | Tropical Forest Soil | GPAPRPLPHYAINLTADGELQVDKLQVIKADQILNV* |
Ga0126381_1019390601 | 3300010376 | Tropical Forest Soil | PDGVKIEGPAPRPLPHFAISLTADGDLLVDKLQIIKPAQVLKV* |
Ga0126381_1020085392 | 3300010376 | Tropical Forest Soil | APRPLPHFAVSLTADGDLLVDKLKNVKASEALKV* |
Ga0138573_12213181 | 3300011089 | Peatlands Soil | PAPRPLPHFSILLTPDGELQVDKLETISANQVLRA* |
Ga0137393_115160731 | 3300011271 | Vadose Zone Soil | KIEGPAQRPLPHFAISVTPDGELLVDKLQDIKPAQVLKV* |
Ga0137388_105988461 | 3300012189 | Vadose Zone Soil | KADGTKIEGPAQRPLPHVAISVTPDGELLVDKLQNIKPAQVLKV* |
Ga0137365_107354922 | 3300012201 | Vadose Zone Soil | DGTKVEGPAPRSLPHFAITLTPDGELLVDKLETIKPGQSLRV* |
Ga0137381_101297864 | 3300012207 | Vadose Zone Soil | QSDGTKVEGPAPRSLPHFAIVLTADGELKVDKLEAINLKQVLKV* |
Ga0137381_111583181 | 3300012207 | Vadose Zone Soil | EGPAPRPLPHFAISVTPDGELLVDKRQNIKPAQVLKV* |
Ga0137378_102878741 | 3300012210 | Vadose Zone Soil | KADGTKIEGPAPRALPHFVISLTADGELLVDKLQNIKPAQVLKV* |
Ga0137378_117920222 | 3300012210 | Vadose Zone Soil | FKSDGTKVEGPAPRSLPHFAITLTPDGELLVDKLEMIKAGQALRV* |
Ga0137384_100823721 | 3300012357 | Vadose Zone Soil | GVKIEGPAPRPLPHFAISLTADGELLVDKLQIIKPSQVLKV* |
Ga0137384_106937082 | 3300012357 | Vadose Zone Soil | EGPAPRALPHFAISLTADGELLVDKLQSIKPAQVLKV* |
Ga0137395_109003841 | 3300012917 | Vadose Zone Soil | APRPLPHFAISLAADGELLVDKLQNIKSEQFLKV* |
Ga0126369_105925723 | 3300012971 | Tropical Forest Soil | DGAKIEGPAPRSLPHFAITLTSDGGLLIDKMETISANQVLRI* |
Ga0126369_125088941 | 3300012971 | Tropical Forest Soil | KPDGGKLEGPAPRSLPHFAISLTPDGQLLVDKLETVNQGQALRV* |
Ga0134110_100216384 | 3300012975 | Grasslands Soil | FEGPAPRPLPHFAISVTPDGELLVDKLQNIKPAQVLKV* |
Ga0120149_11150122 | 3300014058 | Permafrost | FKSDGTKVEGPAPRSLPHFSITLTPDGELLVDKLETIKPGQALRV* |
Ga0182036_104559543 | 3300016270 | Soil | EGPAPRPLPHYAINLTADGELQVDKLQIIKTDQVLKV |
Ga0182036_112869882 | 3300016270 | Soil | EGPAPRPLPHYSISLTADGELLVDKLQTVKSDQVLKT |
Ga0182035_117074741 | 3300016341 | Soil | NGKKIEGPAPRPLPHYAINLTADGELQVDKLQVIKTDQVLKV |
Ga0182039_103364813 | 3300016422 | Soil | PNGKKIEGPAPRPLPHYAINLTADGELQVDKLQTVKADQVLKI |
Ga0182039_117743991 | 3300016422 | Soil | AGPAPAPLPHFLITLTADGELLVNKLQTVRPNQVLGV |
Ga0187849_10910003 | 3300017929 | Peatland | SDGSKIEGPAPRPLPHYSLTLAPNGELVVDKLETVKPDQVLKA |
Ga0187877_14036912 | 3300017931 | Peatland | FQPNGKKIEGPATRSQPLYAINLTADGELQVDKLQIIKADQVLKV |
Ga0187853_103549132 | 3300017940 | Peatland | EGPAPRPLPHYSLTLAPNGELVVDKLEMVKPDQVLKA |
Ga0187817_102252221 | 3300017955 | Freshwater Sediment | PAPRPLPHFSIALTADGELQVDKLNIVNPRDVLKV |
Ga0187817_103660192 | 3300017955 | Freshwater Sediment | GPAPRPLPHFSIGLTPDGELQVDKLETINPNQVLRT |
Ga0187780_110466072 | 3300017973 | Tropical Peatland | GKKIEGPAPRPLPHYAINLTADGELQIDKLQIIKADQVLRV |
Ga0187816_100082271 | 3300017995 | Freshwater Sediment | IEGPAPRPLPHFSISLTADGELQVDKLEVLPLGQVLKV |
Ga0187816_100511991 | 3300017995 | Freshwater Sediment | GPAPRPLPHYAINLTADGELQVNKLETIKPDKVLRA |
Ga0187858_105186222 | 3300018057 | Peatland | SKFQPNGKKIEGPATRSQPLYAINLTADGELQVDKLQITKADQVLKV |
Ga0187784_116799292 | 3300018062 | Tropical Peatland | EGPAPGSLPHYAINLTADGELQVDKLQIIQVDQVLKV |
Ga0187772_113247332 | 3300018085 | Tropical Peatland | GSKFQPNGKKIEEPAPRALPHYAVNLTADGELQVDKLQVIKADQVLKV |
Ga0187769_109765351 | 3300018086 | Tropical Peatland | GSQFQASGKKIGGPAAHSQPHYAINLTADGELQVDKLQVIRADQVLKV |
Ga0187770_107931262 | 3300018090 | Tropical Peatland | EGPAPRPLPHYAINLTVDGELQVDKLQLIKSDQVLKV |
Ga0187770_116955322 | 3300018090 | Tropical Peatland | PAPRPLPHFSVALTADGELLVDKLQVIKADQVLSV |
Ga0210403_104296533 | 3300020580 | Soil | KADGTKIEGPAPRPLPHFSISLTADGELLVDKLQNIRPAQVPKV |
Ga0247688_10477932 | 3300024186 | Soil | KFQPDGKKIEGPAPRPLPHYSIILTADGELLVDKLQTIKADQVLKV |
Ga0247691_10618022 | 3300024222 | Soil | TKIEGPAPRPLPHFALSLTADGELLVDKLQTIKSAQVLKV |
Ga0247677_10621962 | 3300024245 | Soil | GTKIEGPAPRPLPHFAISLTADGELLVDKLQTIKSAQVLKV |
Ga0208819_10055376 | 3300025498 | Peatland | PAPRPLPHYSINLAADGELLVNKLEIIKPDQVLNV |
Ga0209801_11724871 | 3300026326 | Soil | DGTKVEGPAPRPLPHFAISLTSDGELLVDKLQEIKSEQVLKV |
Ga0209648_103190591 | 3300026551 | Grasslands Soil | PAPRPLPHFAIALAADGELLVDKLQNIKSGQVLKV |
Ga0207825_1061111 | 3300026871 | Tropical Forest Soil | KKIEGPAPRPLPHYTINLTADGELQVDKLQVIKTDQVLKV |
Ga0207862_11158882 | 3300027703 | Tropical Forest Soil | GKKIEGPAPRPLPHYAINLTADGELQVDKLQIIKADQVLKV |
Ga0209689_10998883 | 3300027748 | Soil | DGVKIEGPAPRPLPHFAISLAADGELVVDKLQIIKASQVLKV |
Ga0209074_100313173 | 3300027787 | Agricultural Soil | KSDGTKIEGPAPRPLPHFAISLTADGELQVDKLEVISPGQALKA |
Ga0209166_101952123 | 3300027857 | Surface Soil | PAPRPLPHFALSLTADGELLVDKLQSVKNSQALKV |
Ga0209167_103153752 | 3300027867 | Surface Soil | SKFKDDGIKVAGPAPRPLPHFAISLTADGELMVDKLQNVKPAQVLQV |
Ga0209283_104307112 | 3300027875 | Vadose Zone Soil | EGPAPRPLPHFSITLSADGELVVDKLQIVERGQGFKV |
Ga0209590_103781361 | 3300027882 | Vadose Zone Soil | SDGTKVEGPAPRSLPHFPITLTPDGELLVDKLETIKAGQALKV |
Ga0316363_101134713 | 3300030659 | Peatlands Soil | GPAPRPLPHFSVALTADGELLVDKLQVIKADQVLKV |
Ga0265760_100085744 | 3300031090 | Soil | DGAKVAGPAPRPLPHFAISLTADGDLMVDKLQNINPAQALKA |
Ga0170823_139100471 | 3300031128 | Forest Soil | SKFKSDGTKIEGPAPRPLPHFAISLTADGELLVDKLQNIKPTQVLKV |
Ga0170824_1135892782 | 3300031231 | Forest Soil | EGPAPRPLPHFAISLTADGELLVDKLQNIKPEQVLKA |
Ga0310915_112099752 | 3300031573 | Soil | TALGNKIEGPAPRPLPHFLISLTPDGELMVDKLQTVKPGQVLRV |
Ga0318542_100210831 | 3300031668 | Soil | FTPEGTKIVGPAPAPLPHFLITLTADGELLVNKLQTLKPGQVLRV |
Ga0318574_101650143 | 3300031680 | Soil | FQSNGKKLEGPAPRPLPHYAINLTADGELQVDKLQIIKVDQVLRV |
Ga0318560_100601084 | 3300031682 | Soil | KIEGPAPRPLPHYAINLTADGELQVDKLQIIKADQVLRV |
Ga0306918_111744142 | 3300031744 | Soil | KKIEGPAPRPLPHYAINLTADGELQVDKLQVIKADQVLKV |
Ga0318502_102974131 | 3300031747 | Soil | FQPNGKKLEGPAPRPLPHYAINLTADGELQVDKLQIIKVDQVLRV |
Ga0318554_106011512 | 3300031765 | Soil | KKIEGPAPRPLPHYAINLTADGELQVDKLQIIKADQVLRV |
Ga0318552_104756841 | 3300031782 | Soil | QPNGKKIEGPAPRPLPHYAINLTADGELQVDKLQIIKGDQVLRV |
Ga0318529_105431381 | 3300031792 | Soil | IEGPAPRPLPHFALSLTADGELLVNKLQNVKNTQALKV |
Ga0318548_101888781 | 3300031793 | Soil | IEGPAPRPLPHYAINLTADGELQVDKLQIIKADQVLRV |
Ga0306919_111345552 | 3300031879 | Soil | GVKIEGPAPRPLPHFAISLTADGELLVNKLETIKADKALNV |
Ga0306925_108035413 | 3300031890 | Soil | GKKIEGPAPRPLPHYAINLTADGELQVDKLQIIKTDQVLKV |
Ga0306925_120753172 | 3300031890 | Soil | KIEGPAPRPLPHYAINLTADGELQVDKLQIIKTDQVLRV |
Ga0306923_109202091 | 3300031910 | Soil | DGKKIEGPAPRPLPHYAINLTADGELQVDKLRIIKFDQVLKV |
Ga0306921_107523562 | 3300031912 | Soil | GSKFTPEGTKIVGPAPAPLPHFLITLTADGELLVNKLQTVKPGQVLRV |
Ga0310912_106683352 | 3300031941 | Soil | GPAPAPLPHFLITLTADGELLVNKLQTVGPSQVLRA |
Ga0310913_102715373 | 3300031945 | Soil | SKFRSDGAKIEGPAPRPLPHFAISLTADGELLVDKLQIIRASQVLKV |
Ga0310913_109380162 | 3300031945 | Soil | KFKSDGTKIEGPAPRPLPHFAVTLTADGELLVDKLQNIKPTEVLRV |
Ga0310910_113894371 | 3300031946 | Soil | PAPRPLPHYAINLTADGELQVDKLQIIKGDQVLRV |
Ga0310909_105334573 | 3300031947 | Soil | GAKIEGPAPRPLPHFAISLTADGELLVDKLQIIRASQVLKV |
Ga0310911_104275272 | 3300032035 | Soil | PAPRPLPHYAINLTADGELQVDKLRIIKFDQVLKV |
Ga0318532_102960621 | 3300032051 | Soil | KIEGPAPRPLPHYAINLTADGELQVDKLQTTKADEVLRV |
Ga0318533_101099421 | 3300032059 | Soil | SKFTPEGTKIAGPAPAPLPHFLITLTADGELLVNKLQTVGPSQVLRA |
Ga0318533_113609142 | 3300032059 | Soil | EGPAPRPLPHYAINLTADGELQVDKLQTTKADEVLRV |
Ga0318577_102710631 | 3300032091 | Soil | GSKFTPEGTKIAGPAPAPLPHFLITLTADGELLVNKLQTVKPGQVLRV |
Ga0307471_1011778332 | 3300032180 | Hardwood Forest Soil | TKIEGPAPRALPHFAISLTADGELLVDKLQNSKPAQVLKV |
Ga0318519_100311021 | 3300033290 | Soil | GPAPAPLPHFLITLTADGELLVNKLQTLKPGQVLRV |
Ga0314863_128152_420_542 | 3300033804 | Peatland | TKIEGPAPRPLPHFAITLTPDGELMVNKLENVKPSQVLEV |
⦗Top⦘ |