| Basic Information | |
|---|---|
| Taxon OID | 3300024049 Open in IMG/M |
| Scaffold ID | Ga0233359_1046485 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 512 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 40.5253 | Long. (o) | -123.5031 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013830 | Metagenome / Metatranscriptome | 268 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0233359_10464851 | F013830 | N/A | LSIAYVRDKNKIRALELLTALRAQFPENTLFPREIARLQPNFTK |
| ⦗Top⦘ |