| Basic Information | |
|---|---|
| Family ID | F013830 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 268 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LAIAYVREKDKPHARELLSSLRDEFPNNPLFAREIARLDYGH |
| Number of Associated Samples | 220 |
| Number of Associated Scaffolds | 268 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.31 % |
| Associated GOLD sequencing projects | 201 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.239 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.582 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.657 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.507 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.57% β-sheet: 0.00% Coil/Unstructured: 51.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 268 Family Scaffolds |
|---|---|---|
| PF12849 | PBP_like_2 | 66.04 |
| PF13089 | PP_kinase_N | 9.33 |
| PF13090 | PP_kinase_C | 2.61 |
| PF02541 | Ppx-GppA | 1.49 |
| PF01925 | TauE | 1.12 |
| PF03167 | UDG | 1.12 |
| PF13565 | HTH_32 | 1.12 |
| PF14559 | TPR_19 | 0.75 |
| PF02687 | FtsX | 0.75 |
| PF09907 | HigB_toxin | 0.75 |
| PF00300 | His_Phos_1 | 0.37 |
| PF02353 | CMAS | 0.37 |
| PF13358 | DDE_3 | 0.37 |
| PF01551 | Peptidase_M23 | 0.37 |
| PF16976 | RcpC | 0.37 |
| PF08448 | PAS_4 | 0.37 |
| PF04264 | YceI | 0.37 |
| PF13620 | CarboxypepD_reg | 0.37 |
| PF00195 | Chal_sti_synt_N | 0.37 |
| PF03781 | FGE-sulfatase | 0.37 |
| PF13472 | Lipase_GDSL_2 | 0.37 |
| PF13493 | DUF4118 | 0.37 |
| PF01112 | Asparaginase_2 | 0.37 |
| PF03551 | PadR | 0.37 |
| COG ID | Name | Functional Category | % Frequency in 268 Family Scaffolds |
|---|---|---|---|
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 2.99 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.12 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.12 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.12 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 1.12 |
| COG0332 | 3-oxoacyl-[acyl-carrier-protein] synthase III | Lipid transport and metabolism [I] | 0.37 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.37 |
| COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 0.37 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.37 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.37 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.37 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.37 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.37 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.37 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.37 |
| COG3424 | Predicted naringenin-chalcone synthase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.24 % |
| Unclassified | root | N/A | 22.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001174|JGI12679J13547_1000476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1790 | Open in IMG/M |
| 3300001175|JGI12649J13570_1016709 | Not Available | 809 | Open in IMG/M |
| 3300001867|JGI12627J18819_10500006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 500 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100800232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 823 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101706606 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300002560|JGI25383J37093_10031100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1786 | Open in IMG/M |
| 3300004091|Ga0062387_100893629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 671 | Open in IMG/M |
| 3300004633|Ga0066395_10172094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1114 | Open in IMG/M |
| 3300005171|Ga0066677_10824042 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005179|Ga0066684_10614782 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005332|Ga0066388_106012838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 613 | Open in IMG/M |
| 3300005337|Ga0070682_101504729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 579 | Open in IMG/M |
| 3300005340|Ga0070689_100101639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2276 | Open in IMG/M |
| 3300005345|Ga0070692_10190636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1194 | Open in IMG/M |
| 3300005435|Ga0070714_100043096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3815 | Open in IMG/M |
| 3300005435|Ga0070714_101720761 | Not Available | 612 | Open in IMG/M |
| 3300005439|Ga0070711_100133641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1851 | Open in IMG/M |
| 3300005446|Ga0066686_10820672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300005451|Ga0066681_10453945 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300005455|Ga0070663_102004201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 521 | Open in IMG/M |
| 3300005456|Ga0070678_101133198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300005468|Ga0070707_100983148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 809 | Open in IMG/M |
| 3300005534|Ga0070735_10335797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
| 3300005537|Ga0070730_10010117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 7765 | Open in IMG/M |
| 3300005541|Ga0070733_10195790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1320 | Open in IMG/M |
| 3300005542|Ga0070732_10345291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 895 | Open in IMG/M |
| 3300005544|Ga0070686_101888537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 509 | Open in IMG/M |
| 3300005553|Ga0066695_10462991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 781 | Open in IMG/M |
| 3300005569|Ga0066705_10224743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1184 | Open in IMG/M |
| 3300005610|Ga0070763_10827493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300005719|Ga0068861_100774566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 898 | Open in IMG/M |
| 3300005841|Ga0068863_100248815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1717 | Open in IMG/M |
| 3300005842|Ga0068858_100077133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3095 | Open in IMG/M |
| 3300005993|Ga0080027_10009084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3593 | Open in IMG/M |
| 3300006028|Ga0070717_11923513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300006028|Ga0070717_12082023 | Not Available | 511 | Open in IMG/M |
| 3300006052|Ga0075029_100366616 | Not Available | 931 | Open in IMG/M |
| 3300006059|Ga0075017_101667300 | Not Available | 504 | Open in IMG/M |
| 3300006102|Ga0075015_100636709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 627 | Open in IMG/M |
| 3300006162|Ga0075030_100438696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1040 | Open in IMG/M |
| 3300006162|Ga0075030_100810428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 739 | Open in IMG/M |
| 3300006162|Ga0075030_101082156 | Not Available | 631 | Open in IMG/M |
| 3300006163|Ga0070715_10119186 | Not Available | 1256 | Open in IMG/M |
| 3300006173|Ga0070716_101171212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300006173|Ga0070716_101281066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300006174|Ga0075014_100052175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1760 | Open in IMG/M |
| 3300006175|Ga0070712_100753977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300006354|Ga0075021_10047467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2477 | Open in IMG/M |
| 3300006800|Ga0066660_10338052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1217 | Open in IMG/M |
| 3300006806|Ga0079220_11272938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300006871|Ga0075434_100710079 | Not Available | 1023 | Open in IMG/M |
| 3300006871|Ga0075434_101786409 | Not Available | 622 | Open in IMG/M |
| 3300006893|Ga0073928_10060369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3353 | Open in IMG/M |
| 3300006903|Ga0075426_11380983 | Not Available | 535 | Open in IMG/M |
| 3300006954|Ga0079219_11914147 | Not Available | 560 | Open in IMG/M |
| 3300007076|Ga0075435_101727009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 549 | Open in IMG/M |
| 3300007982|Ga0102924_1119928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1278 | Open in IMG/M |
| 3300009088|Ga0099830_11400719 | Not Available | 582 | Open in IMG/M |
| 3300009137|Ga0066709_102480459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300009137|Ga0066709_103069703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300009137|Ga0066709_104354369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300009143|Ga0099792_10601122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300009174|Ga0105241_11220028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300009520|Ga0116214_1154908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300009524|Ga0116225_1560893 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 505 | Open in IMG/M |
| 3300009549|Ga0116137_1042518 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
| 3300009551|Ga0105238_10806369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300009551|Ga0105238_11848334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300009551|Ga0105238_12390063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300009618|Ga0116127_1057732 | Not Available | 1098 | Open in IMG/M |
| 3300009618|Ga0116127_1156330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300009637|Ga0116118_1047666 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300009698|Ga0116216_10717853 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009700|Ga0116217_10662800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300009700|Ga0116217_10851340 | Not Available | 560 | Open in IMG/M |
| 3300009792|Ga0126374_10714641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300009824|Ga0116219_10155848 | Not Available | 1319 | Open in IMG/M |
| 3300010046|Ga0126384_11231821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300010358|Ga0126370_11794210 | Not Available | 593 | Open in IMG/M |
| 3300010358|Ga0126370_12427251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300010359|Ga0126376_10536563 | Not Available | 1092 | Open in IMG/M |
| 3300010360|Ga0126372_12475270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300010360|Ga0126372_13160718 | Not Available | 512 | Open in IMG/M |
| 3300010362|Ga0126377_13620147 | Not Available | 500 | Open in IMG/M |
| 3300010366|Ga0126379_13830135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300010371|Ga0134125_10302537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1776 | Open in IMG/M |
| 3300010373|Ga0134128_10404938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1523 | Open in IMG/M |
| 3300010375|Ga0105239_11262512 | Not Available | 852 | Open in IMG/M |
| 3300010379|Ga0136449_101608741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 986 | Open in IMG/M |
| 3300010379|Ga0136449_102003028 | Not Available | 855 | Open in IMG/M |
| 3300010397|Ga0134124_10041971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3829 | Open in IMG/M |
| 3300010397|Ga0134124_10659308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300010937|Ga0137776_1552449 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 500 | Open in IMG/M |
| 3300011269|Ga0137392_10341621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300012096|Ga0137389_10341535 | Not Available | 1273 | Open in IMG/M |
| 3300012205|Ga0137362_11731254 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012206|Ga0137380_11161969 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012209|Ga0137379_11761393 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300012211|Ga0137377_11833161 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012212|Ga0150985_114153769 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012350|Ga0137372_11232422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300012354|Ga0137366_10003988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11509 | Open in IMG/M |
| 3300012354|Ga0137366_11132051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300012359|Ga0137385_11073808 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012469|Ga0150984_104743079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1988 | Open in IMG/M |
| 3300012500|Ga0157314_1021509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012923|Ga0137359_10839555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 794 | Open in IMG/M |
| 3300012929|Ga0137404_10873765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300012955|Ga0164298_10437182 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012960|Ga0164301_11590159 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012960|Ga0164301_11614745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300012961|Ga0164302_11464766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 561 | Open in IMG/M |
| 3300012975|Ga0134110_10227755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300012986|Ga0164304_10460375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
| 3300013307|Ga0157372_10726581 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1155 | Open in IMG/M |
| 3300014157|Ga0134078_10260635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300014501|Ga0182024_10306565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2096 | Open in IMG/M |
| 3300014655|Ga0181516_10005967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7401 | Open in IMG/M |
| 3300015261|Ga0182006_1018691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2924 | Open in IMG/M |
| 3300015262|Ga0182007_10120672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300015373|Ga0132257_101190438 | Not Available | 964 | Open in IMG/M |
| 3300016404|Ga0182037_11809334 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300016445|Ga0182038_11034494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300017823|Ga0187818_10107756 | Not Available | 1206 | Open in IMG/M |
| 3300017927|Ga0187824_10318155 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300017933|Ga0187801_10024357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2083 | Open in IMG/M |
| 3300017935|Ga0187848_10047661 | All Organisms → cellular organisms → Bacteria | 2076 | Open in IMG/M |
| 3300017940|Ga0187853_10345618 | Not Available | 665 | Open in IMG/M |
| 3300017943|Ga0187819_10188173 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300017955|Ga0187817_10566690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300017961|Ga0187778_10254127 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300017966|Ga0187776_10026293 | All Organisms → cellular organisms → Bacteria | 3211 | Open in IMG/M |
| 3300017970|Ga0187783_10835492 | Not Available | 664 | Open in IMG/M |
| 3300017970|Ga0187783_10949109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300017974|Ga0187777_10876595 | Not Available | 644 | Open in IMG/M |
| 3300017975|Ga0187782_10207809 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300017999|Ga0187767_10092845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300018013|Ga0187873_1055512 | Not Available | 1692 | Open in IMG/M |
| 3300018034|Ga0187863_10400877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 765 | Open in IMG/M |
| 3300018058|Ga0187766_10847682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300018062|Ga0187784_10788734 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300018082|Ga0184639_10257457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300018086|Ga0187769_10601182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300018086|Ga0187769_10662511 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300018088|Ga0187771_10358337 | Not Available | 1227 | Open in IMG/M |
| 3300018090|Ga0187770_10819403 | Not Available | 745 | Open in IMG/M |
| 3300019786|Ga0182025_1128485 | Not Available | 1661 | Open in IMG/M |
| 3300019885|Ga0193747_1132174 | Not Available | 582 | Open in IMG/M |
| 3300019888|Ga0193751_1084060 | Not Available | 1263 | Open in IMG/M |
| 3300020579|Ga0210407_10014297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5899 | Open in IMG/M |
| 3300020581|Ga0210399_10470098 | Not Available | 1046 | Open in IMG/M |
| 3300020581|Ga0210399_11524644 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 518 | Open in IMG/M |
| 3300020583|Ga0210401_10713753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300021168|Ga0210406_10428929 | Not Available | 1055 | Open in IMG/M |
| 3300021171|Ga0210405_10939911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300021181|Ga0210388_10426514 | Not Available | 1165 | Open in IMG/M |
| 3300021377|Ga0213874_10377279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300021401|Ga0210393_10242872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300021402|Ga0210385_10136944 | Not Available | 1741 | Open in IMG/M |
| 3300021402|Ga0210385_11130854 | Not Available | 601 | Open in IMG/M |
| 3300021403|Ga0210397_10069990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2297 | Open in IMG/M |
| 3300021404|Ga0210389_10685119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 803 | Open in IMG/M |
| 3300021407|Ga0210383_10086541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2627 | Open in IMG/M |
| 3300021420|Ga0210394_10168126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1908 | Open in IMG/M |
| 3300021474|Ga0210390_10598852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300021478|Ga0210402_11296125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300021478|Ga0210402_11356197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 638 | Open in IMG/M |
| 3300021479|Ga0210410_10952161 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300021559|Ga0210409_10599824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
| 3300021560|Ga0126371_12352375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300022532|Ga0242655_10001822 | All Organisms → cellular organisms → Bacteria | 3091 | Open in IMG/M |
| 3300022557|Ga0212123_10246062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1287 | Open in IMG/M |
| 3300022557|Ga0212123_10254735 | Not Available | 1257 | Open in IMG/M |
| 3300022563|Ga0212128_10006615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7551 | Open in IMG/M |
| 3300022733|Ga0224562_1013631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300024049|Ga0233359_1046485 | Not Available | 512 | Open in IMG/M |
| 3300024331|Ga0247668_1028813 | Not Available | 1141 | Open in IMG/M |
| 3300025910|Ga0207684_11207907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300025911|Ga0207654_10728571 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300025911|Ga0207654_11407981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300025914|Ga0207671_10351156 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300025916|Ga0207663_10002477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8894 | Open in IMG/M |
| 3300025916|Ga0207663_10112751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1848 | Open in IMG/M |
| 3300025916|Ga0207663_11046576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300025917|Ga0207660_10113896 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300025928|Ga0207700_10162683 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300025929|Ga0207664_10006473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8059 | Open in IMG/M |
| 3300025929|Ga0207664_10464967 | Not Available | 1130 | Open in IMG/M |
| 3300025939|Ga0207665_10453998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300025949|Ga0207667_11638838 | Not Available | 611 | Open in IMG/M |
| 3300025949|Ga0207667_12051312 | Not Available | 531 | Open in IMG/M |
| 3300026023|Ga0207677_11046514 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 742 | Open in IMG/M |
| 3300026041|Ga0207639_12298501 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 501 | Open in IMG/M |
| 3300026088|Ga0207641_10372640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1365 | Open in IMG/M |
| 3300026142|Ga0207698_11667997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
| 3300026281|Ga0209863_10017370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2229 | Open in IMG/M |
| 3300026281|Ga0209863_10158465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300026301|Ga0209238_1184283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300026304|Ga0209240_1244292 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300026322|Ga0209687_1306883 | Not Available | 505 | Open in IMG/M |
| 3300026332|Ga0209803_1102838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1165 | Open in IMG/M |
| 3300026332|Ga0209803_1327272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 528 | Open in IMG/M |
| 3300026548|Ga0209161_10562737 | Not Available | 509 | Open in IMG/M |
| 3300026551|Ga0209648_10673597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300026552|Ga0209577_10440373 | Not Available | 914 | Open in IMG/M |
| 3300026854|Ga0207727_117989 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300027439|Ga0209332_1039224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300027575|Ga0209525_1005866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2845 | Open in IMG/M |
| 3300027576|Ga0209003_1049480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300027610|Ga0209528_1057501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300027610|Ga0209528_1078991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300027645|Ga0209117_1151224 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300027648|Ga0209420_1118623 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300027648|Ga0209420_1141666 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300027745|Ga0209908_10242695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 506 | Open in IMG/M |
| 3300027795|Ga0209139_10220354 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300027829|Ga0209773_10404145 | Not Available | 566 | Open in IMG/M |
| 3300027857|Ga0209166_10006652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7769 | Open in IMG/M |
| 3300027862|Ga0209701_10185367 | Not Available | 1249 | Open in IMG/M |
| 3300027862|Ga0209701_10474639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300027867|Ga0209167_10815665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 508 | Open in IMG/M |
| 3300027903|Ga0209488_10178132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1605 | Open in IMG/M |
| 3300027903|Ga0209488_10479600 | Not Available | 913 | Open in IMG/M |
| 3300027911|Ga0209698_10013007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8233 | Open in IMG/M |
| 3300028047|Ga0209526_10528821 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300028775|Ga0302231_10351802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300028828|Ga0307312_10761033 | Not Available | 642 | Open in IMG/M |
| 3300029999|Ga0311339_10212220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2174 | Open in IMG/M |
| 3300030044|Ga0302281_10265805 | Not Available | 694 | Open in IMG/M |
| 3300030058|Ga0302179_10536584 | Not Available | 513 | Open in IMG/M |
| 3300030507|Ga0302192_10394277 | Not Available | 567 | Open in IMG/M |
| 3300030646|Ga0302316_10298075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300030706|Ga0310039_10086522 | Not Available | 1327 | Open in IMG/M |
| 3300030706|Ga0310039_10403311 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300031057|Ga0170834_106538211 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031057|Ga0170834_106610989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1889 | Open in IMG/M |
| 3300031573|Ga0310915_10448439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300031708|Ga0310686_102547513 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 545 | Open in IMG/M |
| 3300031708|Ga0310686_111186522 | Not Available | 2871 | Open in IMG/M |
| 3300031708|Ga0310686_119233381 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300031718|Ga0307474_10087338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2325 | Open in IMG/M |
| 3300031753|Ga0307477_10047623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2946 | Open in IMG/M |
| 3300031754|Ga0307475_10456985 | Not Available | 1026 | Open in IMG/M |
| 3300031754|Ga0307475_10660173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300031949|Ga0214473_11039939 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300031954|Ga0306926_10373882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1761 | Open in IMG/M |
| 3300031962|Ga0307479_10032022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5014 | Open in IMG/M |
| 3300031962|Ga0307479_10817717 | Not Available | 907 | Open in IMG/M |
| 3300031962|Ga0307479_11287152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300031962|Ga0307479_11565264 | Not Available | 615 | Open in IMG/M |
| 3300031962|Ga0307479_11807487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300032001|Ga0306922_11115967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
| 3300032180|Ga0307471_100659467 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300032180|Ga0307471_103013586 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300032180|Ga0307471_103504865 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300032205|Ga0307472_100664418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 931 | Open in IMG/M |
| 3300032205|Ga0307472_100854366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 838 | Open in IMG/M |
| 3300032770|Ga0335085_11527984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300032783|Ga0335079_11282722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300032805|Ga0335078_11808426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300032828|Ga0335080_11730865 | Not Available | 612 | Open in IMG/M |
| 3300032896|Ga0335075_11508332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300032897|Ga0335071_11793068 | Not Available | 558 | Open in IMG/M |
| 3300032898|Ga0335072_11052218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300032955|Ga0335076_10081367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3177 | Open in IMG/M |
| 3300033412|Ga0310810_10175492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2456 | Open in IMG/M |
| 3300033417|Ga0214471_11428397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300033829|Ga0334854_156809 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.22% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.73% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.73% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.24% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.49% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.49% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.49% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.49% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.49% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.12% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.75% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.75% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.75% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.75% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.75% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.75% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.37% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.37% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.37% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.37% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.37% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.37% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.37% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.37% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300024049 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026854 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030044 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12679J13547_10004763 | 3300001174 | Forest Soil | EKDKSRALQLLTGLRQDFPGNTLFPREIAHLQSSH* |
| JGI12649J13570_10167092 | 3300001175 | Forest Soil | LAIAYVREKNKVRALELLSALRSQFPGNTVFPREIARLQAGH* |
| JGI12627J18819_105000061 | 3300001867 | Forest Soil | AYVREKDKPRAREMLASLRDDFPKNPLFAREIARLDSLH* |
| JGIcombinedJ26739_1008002321 | 3300002245 | Forest Soil | LLAIAYVRDKDKSRALQMLAGLRTEFPGNTLFPREIARLEQAR* |
| JGIcombinedJ26739_1017066061 | 3300002245 | Forest Soil | KDRTRALQLLSGLRTEFPGNPLYGREIARLQMGH* |
| JGI25383J37093_100311001 | 3300002560 | Grasslands Soil | IAYVREKDQPRAREMLASLRDEFPKNPLFAREIARLDNLR* |
| Ga0062387_1008936291 | 3300004091 | Bog Forest Soil | ILLAIAYVRDKDNERALNVLKSLRTQFPANTLFPREIARLQNGH* |
| Ga0066395_101720942 | 3300004633 | Tropical Forest Soil | LAIAYVREKDKARAIELLASLRDEFPTNPLFQNELARLNTGP* |
| Ga0066677_108240421 | 3300005171 | Soil | NILLAIAYVRDHDKKHARELLASLRDEFPANPLFAQEIAKLDAVH* |
| Ga0066684_106147822 | 3300005179 | Soil | AYVREKDKPRALELLSGLEREFPSNTLFPREIARLQSAH* |
| Ga0066388_1060128382 | 3300005332 | Tropical Forest Soil | IAYVREKDTAKAQELLASLRDQYPKNPLFAREIARLQAQ* |
| Ga0070682_1015047292 | 3300005337 | Corn Rhizosphere | ILLAIAYVRDKDNARARAVLATLRDEFPKNPLFAREIARLDAGH* |
| Ga0070689_1001016391 | 3300005340 | Switchgrass Rhizosphere | FARILLAIAYVRDKDNGRAREVLAALRDEFPKNPLFAREIARLDAGH* |
| Ga0070692_101906362 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LGPFARILLAIAYVRDKDNGRAREVLAALRDEFPKNPLFAREIARLDAGH* |
| Ga0070714_1000430961 | 3300005435 | Agricultural Soil | AYVREKDKPRAMQLLTSLHAEFPDNTLFPREIAHLQAPR* |
| Ga0070714_1017207611 | 3300005435 | Agricultural Soil | AYVREKDKPRAVELLSGLQREFPGNTLFPRQIEHLQRSR* |
| Ga0070711_1001336411 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ILLSIAYVREKKKAHAIELLADLQREFPGNSLFPRQIAHLRSSQK* |
| Ga0066686_108206722 | 3300005446 | Soil | LAIAYVRDHDKAHARELLGSLREQFPANPLFEQEIARLDAAR* |
| Ga0066681_104539452 | 3300005451 | Soil | ARMLLAVTYLRDKDTRHARELLSGLRDEFPANPLFAREVARIDHNHGGQ* |
| Ga0070663_1020042011 | 3300005455 | Corn Rhizosphere | ILLAIAYVREHDKPQARALLASLQQEFPNNTLFAREIARIDSAR* |
| Ga0070678_1011331982 | 3300005456 | Miscanthus Rhizosphere | LLAIAYVRDHDKQSARQLLSRLHEEFPANPLFSQEMARLDTAH* |
| Ga0070707_1009831482 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ILLAIAYVRDKNKTRALELLMALRTQFPGNTLFPREIARLQPSITIAK* |
| Ga0070735_103357971 | 3300005534 | Surface Soil | YVRDKNKDRALELLNSLRADFPGNTLFPREIGRLQSQVSR* |
| Ga0070730_100101171 | 3300005537 | Surface Soil | LLAIAYTREKNKPRAIELLAGLQKEFPGNTLFARQIAHLQAGR* |
| Ga0070733_101957902 | 3300005541 | Surface Soil | RILLSIAYVREKEKSRALELLSGLQHEFPANTLFPREIAHLQSSR* |
| Ga0070732_103452912 | 3300005542 | Surface Soil | RILLAIAYVREKNKPRALELLAGLQREFPGNTLFPREIAHLRTVH* |
| Ga0070686_1018885371 | 3300005544 | Switchgrass Rhizosphere | LLAIAYVRDHDKQRARQLLSQLHQEFPANPLFSQEMARLDAGR* |
| Ga0066695_104629911 | 3300005553 | Soil | ILLAVAYVREHDNQHARELLASLRDRFPANPLFAQEIARLDSNK* |
| Ga0066705_102247433 | 3300005569 | Soil | AYVREKDKPHARELLSSLRDEFPNNPLFAREIARLDYGH* |
| Ga0070763_108274932 | 3300005610 | Soil | LSIAYVRDENKIRALELLMALRAQFPGNTLFPREIARLQPNVSK* |
| Ga0068861_1007745662 | 3300005719 | Switchgrass Rhizosphere | IAYVREKDKPKAREVLSSLRDEFPNNPLFAREISRLDTGN* |
| Ga0068863_1002488151 | 3300005841 | Switchgrass Rhizosphere | EHDKPQARALLASLQQEFPNNTLFAREIARIDSAR* |
| Ga0068858_1000771333 | 3300005842 | Switchgrass Rhizosphere | YVRDKDNGRAREVLAALRDEFPKNPLFAREIARLDSGH* |
| Ga0080027_100090841 | 3300005993 | Prmafrost Soil | EHDKTHARQLLASLRDQYPGNPLFAQEIARLDSGH* |
| Ga0070717_119235131 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DILLAIAYVREHDKQHARQLLSQLHDEFPANPLFPQEMARLDKGK* |
| Ga0070717_120820232 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IAYVREKDKRRAMQLLTNLHNQFPANTLFPREIAHLQAAR* |
| Ga0075029_1003666162 | 3300006052 | Watersheds | YVREKDKSRAIELLAGLRAEYPANPLFDREISRLESSH* |
| Ga0075017_1016673001 | 3300006059 | Watersheds | LAIAYVRDKDNARARDLLAHLRDEFPKNTLFPREIARLDAGH* |
| Ga0075015_1006367091 | 3300006102 | Watersheds | FARILLAIAYVRDKDNPHARGVLAALRDEFPKNPLFAREIARLDAMH* |
| Ga0075030_1004386962 | 3300006162 | Watersheds | LAIAYVREKDKPRARDLLVALRDEFPSNPLFAQEIARLSTQPLSGNQP* |
| Ga0075030_1008104281 | 3300006162 | Watersheds | PFARILLAIAYVREKDRPRALELLAGLQRAFPGSTLFPREIAHLRAAH* |
| Ga0075030_1010821562 | 3300006162 | Watersheds | LLSIAYVREKDRARALELLAGLQREFPGNTLFPREIAHLRAAH* |
| Ga0070715_101191861 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | IAYVRDKDNVRARELLASLRDEFPKNTLFTNEIARLDAGH* |
| Ga0070716_1011712122 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VRDHDKKHARELLASLRDEFPANPLFSQEIARLDESH* |
| Ga0070716_1012810662 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | YVREKDKPRAREMLASLRDDFPKNPLFAREIARLDSLH* |
| Ga0075014_1000521751 | 3300006174 | Watersheds | ARILLAIAYVRDKDKPRALQLLTGLRREFPGNTLFPREIAHLQAAHEVHQK* |
| Ga0070712_1007539771 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KDNNKARELLANLRDEFPKNTLFPREIARLDAGH* |
| Ga0075021_100474674 | 3300006354 | Watersheds | LLAIAYVREKDKPRARELLVSLRDEFPQNLLFTQEIARLDTQPLSGNRP* |
| Ga0066660_103380521 | 3300006800 | Soil | VREKDKSSALQMMAGLQRDFPGNTLFPREIANLQSGR* |
| Ga0079220_112729381 | 3300006806 | Agricultural Soil | NILLAIAYVRDHDKKHARELLASLRDEFPANPLFSQEIARLDESH* |
| Ga0075434_1007100791 | 3300006871 | Populus Rhizosphere | IAFVRDKDNARARGVLAALRDEFPRNPLFAREIARLDAIH* |
| Ga0075434_1017864091 | 3300006871 | Populus Rhizosphere | IAYVREKDKPSALTMLASLRDEFPKNPLFAREIARLDTRN* |
| Ga0073928_100603691 | 3300006893 | Iron-Sulfur Acid Spring | PLARILLAIAYVREKDNSRALQLLTGLRSEFPANTLFPREIAHLRDAPQR* |
| Ga0075426_113809832 | 3300006903 | Populus Rhizosphere | REKDKPRALELLGGLRREFPGNSLFPREIAHLEASR* |
| Ga0079219_119141471 | 3300006954 | Agricultural Soil | IAYVREKNRPRAIALLSGLEQDFPGNSLFPREIEHLRSAR* |
| Ga0075435_1017270091 | 3300007076 | Populus Rhizosphere | IAYVREKDTARAQELLASLRDQYPKNPLFAREIARLQAQ* |
| Ga0102924_11199282 | 3300007982 | Iron-Sulfur Acid Spring | FARILLAIAYVREKDKPRARQLLISLRDQFPKNPLFEQEIARLDTWPAPDN* |
| Ga0099830_114007191 | 3300009088 | Vadose Zone Soil | RILLAIAYVRDKDNNRARELLASLRDEFPKNTLFTNEIARLDAGH* |
| Ga0066709_1024804592 | 3300009137 | Grasslands Soil | AYVREKDRPRALELLAGLQREFPGNTLFPREIAHLRAVH* |
| Ga0066709_1030697031 | 3300009137 | Grasslands Soil | IAYVRDHDKKHARELLASLRDEFPANPLFAQEIAKLDAVH* |
| Ga0066709_1043543691 | 3300009137 | Grasslands Soil | RILLAIAYVREKDQPRAREMLASLRDEFPKNPLFAREIAHLDNLR* |
| Ga0099792_106011221 | 3300009143 | Vadose Zone Soil | ARVLLAIAYVRDKDKPRALELLTSLRAQFPNNTLFPREIIRLQASQ* |
| Ga0105241_112200281 | 3300009174 | Corn Rhizosphere | ILLAIAYVRDHDKKHARELLASLRDEFPANPLFAQEIARLDEVH* |
| Ga0116214_11549082 | 3300009520 | Peatlands Soil | ARILLAIAYVREKDKMRARELLVSLRNEFPQNPLFAQEIARLDTQPGSGDRP* |
| Ga0116225_15608932 | 3300009524 | Peatlands Soil | AIAYVRDKDKSRALQLLTSLRSQFPGNTLFPREISRLQSAH* |
| Ga0116137_10425182 | 3300009549 | Peatland | ARILLAIAYVRDNNKPRALELLASLRSEFPGNTLFPREIARLQTSISIPK* |
| Ga0105238_108063692 | 3300009551 | Corn Rhizosphere | LLAIAYVRDHDKKHARELLASLRDEFPANPLFSQEIARLDESH* |
| Ga0105238_118483341 | 3300009551 | Corn Rhizosphere | VRDHDKQRARELLAALRTEFPTNPLFGQEIARLDSGQ* |
| Ga0105238_123900632 | 3300009551 | Corn Rhizosphere | APFADILLAIAYVRDHDKQRARQLLSQLHQEFPANPLFSQEMARLDAGR* |
| Ga0116127_10577322 | 3300009618 | Peatland | ILLAIAYVRDKNKPRALELLASLRSEFPGNTLFPREIARLRTSH* |
| Ga0116127_11563302 | 3300009618 | Peatland | ILLAIAYVRDKNKPRALELLASLRSEFPGNTLFPREIARLQTSISIPK* |
| Ga0116118_10476661 | 3300009637 | Peatland | FARILLAIAYVRDKNKPRALELLASLRSEFPGNTLFPREIARLQTSISIPK* |
| Ga0116216_107178531 | 3300009698 | Peatlands Soil | YVREKDKPRALQMLAGLRLEFPGNTLFAREIAHLQAAK* |
| Ga0116217_106628001 | 3300009700 | Peatlands Soil | APFARILLAIAYLRDNDRPRAIQLLIGLRAEFPANPLFSREIARLQPAP* |
| Ga0116217_108513401 | 3300009700 | Peatlands Soil | LLAIAYVRDKDKVRALELLTALRTQFPGNTLFPREIARLTPSVTAAH* |
| Ga0126374_107146412 | 3300009792 | Tropical Forest Soil | FANILLAIAYVREHDKQHARELLASLRDHYPKNPLFGRELARLDSAR* |
| Ga0116219_101558481 | 3300009824 | Peatlands Soil | RILLAIAYVRDKDKSRALQLLTSLRSQFPGNTLFPREISRLQSAH* |
| Ga0126384_112318212 | 3300010046 | Tropical Forest Soil | FARILLAIAYVREKDTVKARELLAGLRDQYPKNPLFAREIARLQAH* |
| Ga0126370_117942102 | 3300010358 | Tropical Forest Soil | RILLAIAYVRDKDKPKAREVLTSLRNEFPNNPLFAREIARPDSSNP* |
| Ga0126370_124272511 | 3300010358 | Tropical Forest Soil | AHILLAIAYVREQDKPHAREILTSLHQQFPANPLFAQEIAKLDGKR* |
| Ga0126376_105365631 | 3300010359 | Tropical Forest Soil | ILLSIAYVREKNNEMALEVLTALQREFPGNPLFSREISRLRATVRSR* |
| Ga0126372_124752702 | 3300010360 | Tropical Forest Soil | AIAYVREHDKQHAREILASLREQFPANPLFAQEIAKLDAKR* |
| Ga0126372_131607181 | 3300010360 | Tropical Forest Soil | AIAYVRDKDKPKAREVLTSLRDEFPNNPLFSREIARLDSAK* |
| Ga0126377_136201471 | 3300010362 | Tropical Forest Soil | IAYVREKDTVKARELLAGLRDQYPKNPLFAREIARLQAH* |
| Ga0126379_138301352 | 3300010366 | Tropical Forest Soil | AVAYLRDKDTRHARELLAGLRDQFPANPLFAREIARLDHDRSGGE* |
| Ga0134125_103025373 | 3300010371 | Terrestrial Soil | ILLAIAYVREKDKPRARELLTGLRQQFPNNSLFTREIARLDGVKVVNP* |
| Ga0134128_104049381 | 3300010373 | Terrestrial Soil | LAPFADILLAIAYVRDHDKQHARQLLAQLHDEFPENPLFPQEMARLDQAK* |
| Ga0105239_112625122 | 3300010375 | Corn Rhizosphere | PFARILLAIAYVREKDKPSALTMLASLRDEFPKNPLFAREIARLDTRN* |
| Ga0136449_1016087412 | 3300010379 | Peatlands Soil | FARILLAIAYVRDKEKARARELLVALQNDFPQNPLFGREISRLDGQR* |
| Ga0136449_1020030281 | 3300010379 | Peatlands Soil | ARILLAIAYVREKDRPRAREILASLRDEFPRNPLFAREIARLDLER* |
| Ga0134124_100419714 | 3300010397 | Terrestrial Soil | RILLAIAYVREKDTMKARELLASLRDQYPKNPLFAREIARLQAQ* |
| Ga0134124_106593082 | 3300010397 | Terrestrial Soil | LLAIAYVREHDKPRARQLLASLRDEFPANPLFAQEIARLDESR* |
| Ga0137776_15524491 | 3300010937 | Sediment | VREKNRGAAIELLSGLRQEFPGNTLFPREIARLQTAH* |
| Ga0137392_103416213 | 3300011269 | Vadose Zone Soil | VHDKDKPRARALLASLRDEFPNNPLFAREIARLDSGQ* |
| Ga0137389_103415351 | 3300012096 | Vadose Zone Soil | EKDKPHARELLASLRDEFPQNPLFAREIARLDSGP* |
| Ga0137362_117312542 | 3300012205 | Vadose Zone Soil | ARILLAIAYVRDKNKPRALELLIALRTQFPGNTLFPREIARLQPAIGSPRAR* |
| Ga0137380_111619692 | 3300012206 | Vadose Zone Soil | LLAIAYVREHDYKHARELLASLRDQFPANPLFAQEIARLDAGN* |
| Ga0137379_117613932 | 3300012209 | Vadose Zone Soil | REKDKRRAMQLLTDLHSQFPANTLFPREIAHLQAAR* |
| Ga0137377_118331612 | 3300012211 | Vadose Zone Soil | FANILLSIAYVRDHDKQHARELLASLRDQFPGNPLFAEEIARLDASP* |
| Ga0150985_1141537692 | 3300012212 | Avena Fatua Rhizosphere | ILLAIAYVRDKDNGKARELLARLRDEFPKNTLFPREIARLDAAH* |
| Ga0137372_112324222 | 3300012350 | Vadose Zone Soil | YVRDHENQRARELLGSLRDQFPANPLFAREIARLDSGR* |
| Ga0137366_100039881 | 3300012354 | Vadose Zone Soil | REHDNKRARELLATLRDQFPANPLFAQEIARLDSGR* |
| Ga0137366_111320511 | 3300012354 | Vadose Zone Soil | YVREKDKPRALLLLAGLRSEFPGNTLFPREIAHLQTAH* |
| Ga0137385_110738082 | 3300012359 | Vadose Zone Soil | LAIAYVREKDKPHARELLSSLRDEFPNNPLFAREIARLDYGH* |
| Ga0150984_1047430791 | 3300012469 | Avena Fatua Rhizosphere | RSLLAIAYVRDKDREHAREVLSSLRQDFPNNPLFGKEIARLSQE* |
| Ga0157314_10215091 | 3300012500 | Arabidopsis Rhizosphere | FARILLAIAFVREHKRPEARALLASLQQEFPNNPLFAREIARIDSSR* |
| Ga0137359_108395551 | 3300012923 | Vadose Zone Soil | IAYVREKDKPRAMQLLMGLRREFPANTLFPREIAHLQAAH* |
| Ga0137404_108737651 | 3300012929 | Vadose Zone Soil | IAYVRDKDKPKAREILTSLRDEFPNNPLFAREISRLDSGN* |
| Ga0164298_104371822 | 3300012955 | Soil | REKDKAHALEVLSGLEREFPSNTLFPREIARLQSAR* |
| Ga0164301_115901592 | 3300012960 | Soil | RILLAIAYVREKNKAHALELLSGLQHEFPGNTLFPREIARLQSAR* |
| Ga0164301_116147452 | 3300012960 | Soil | IAYVRDHDKKHARELLASLRDEFPANPLFSQEIARLDESH* |
| Ga0164302_114647661 | 3300012961 | Soil | FARILLAIAYVREKDKPKAREVLSLLRDEFPNNPLFAREILRLDTGN* |
| Ga0134110_102277552 | 3300012975 | Grasslands Soil | FANILLAVAYVREHDNQHARDLLASLRDQFPANPLFAQEIARLDSNK* |
| Ga0164304_104603752 | 3300012986 | Soil | PFARILLAIAYVRDKDNSKARELLANLRDEFPKNTLFPREIARLDAGH* |
| Ga0157372_107265812 | 3300013307 | Corn Rhizosphere | FADILLAIAYVRDHDKQHARQLLAQLHDEFPANPLFPQEMARLDKGK* |
| Ga0134078_102606351 | 3300014157 | Grasslands Soil | KDKPRAREILASLRDEFPKNPLFAREIARLDSIH* |
| Ga0182024_103065653 | 3300014501 | Permafrost | AYVREKHKQRALQLLSSLQVQFPGNTLFPREIARLQSGR* |
| Ga0181516_100059678 | 3300014655 | Bog | FARILLAIAYVRDKNKTEARQVLAGLRTEFPDNPPFDREISRLDQTR* |
| Ga0182006_10186911 | 3300015261 | Rhizosphere | IAYVRDKDREHAREVLSSLRQDFPNNPLFGKEIARLSQE* |
| Ga0182007_101206721 | 3300015262 | Rhizosphere | ILLAIAYVREKDKGRALQLLAGLQREFPGNTLFPREIARLQATH* |
| Ga0132257_1011904381 | 3300015373 | Arabidopsis Rhizosphere | ILLAIAYVREKDKPKAREVLSLLRDEFPNNPLFAREILRLDTGS* |
| Ga0182037_118093342 | 3300016404 | Soil | YVRDHDKTQARALLASLRDEFPTNPLFAQEIARLDSR |
| Ga0182038_110344941 | 3300016445 | Soil | AYVREKEKPQAVELLSELQREFPGSPLFPRQIEHLQRSH |
| Ga0187818_101077562 | 3300017823 | Freshwater Sediment | AIAYVRDKDKPRAREILASLRDEFPGNPLFAREIARLDSQ |
| Ga0187824_103181551 | 3300017927 | Freshwater Sediment | LLAIAYVREKDKARALQLLAGLRDEYPGNSLFPREISRLEKTR |
| Ga0187801_100243571 | 3300017933 | Freshwater Sediment | RILLAIAYVREKDKARARELLVSLRNEFPQNPLFTQEIARLDTQISSNRP |
| Ga0187848_100476613 | 3300017935 | Peatland | APFARILLAIAYVRDKNKPRALELLASLRSEFPGNTLFPREIARLQTSISIPK |
| Ga0187853_103456181 | 3300017940 | Peatland | PFARILLAIAYVRDKDKARALEVLQSLRTQFPANTLFPREIARLQDGH |
| Ga0187819_101881732 | 3300017943 | Freshwater Sediment | FARILLAIVYVREKDKARALQLLNGLRTEFPANTLFPREIARLQTAP |
| Ga0187817_105666901 | 3300017955 | Freshwater Sediment | ILLAIAYVREKDKTRARDLLVLLRNDFPQNPLFAQEIGRLDAQR |
| Ga0187778_102541272 | 3300017961 | Tropical Peatland | FARILLAIAYVREKDKAHARELLISLRQDFPQNPLFAREIGRLDGQP |
| Ga0187776_100262933 | 3300017966 | Tropical Peatland | FARILLAIAYVRDKDRPRAREVLLSLKKDFPNNHLFPLELARLDQSATP |
| Ga0187783_108354922 | 3300017970 | Tropical Peatland | AIAYVRENDKSRARELLVSLREDFPQNPLFAREIDRLDQQR |
| Ga0187783_109491092 | 3300017970 | Tropical Peatland | LLAIACVREKDKTRAVELLTALRHDFPGNTLFPREIARLQAAH |
| Ga0187777_108765952 | 3300017974 | Tropical Peatland | FARILLAIAYVRDRDNTRAREILAALRDEFPKNPLFAHEIARLDGVQINDSMH |
| Ga0187782_102078092 | 3300017975 | Tropical Peatland | RDNNKPRAREMLVSLEQEFPQNPLFAREIGRLDAER |
| Ga0187767_100928451 | 3300017999 | Tropical Peatland | ARILLALAYLREKDTPRARELLVSLRNDFPENPLFAREIGRLDAQR |
| Ga0187873_10555121 | 3300018013 | Peatland | FARILLAIAYVRDKDVPRARELLLALQREFPDNTLFGRELTRLDHNGNR |
| Ga0187863_104008772 | 3300018034 | Peatland | YLKPFARILLAIAYVRDKDKTRALELLVALRTQFPGNTLFPREIARLTPSATSAH |
| Ga0187766_108476821 | 3300018058 | Tropical Peatland | RILLAIAYVREKDKSRALQQLTELRTHYPANTLVSREIARLQSSE |
| Ga0187784_107887342 | 3300018062 | Tropical Peatland | ARILLAIAYVRDKEKARALEVLSALRADFPGNTLFPREIMRLQSAH |
| Ga0184639_102574572 | 3300018082 | Groundwater Sediment | DKDTGRARALLAGLRDEFPKNPLFAREIARLDAGQ |
| Ga0187769_106011822 | 3300018086 | Tropical Peatland | PFARVLLAIAYVRDKDKARALDLLTSLRTEFPGNPLFPREISRLQGGR |
| Ga0187769_106625112 | 3300018086 | Tropical Peatland | AYVREKDKTRALELLTGLRQEFPANTLFSREIVRLEGAH |
| Ga0187771_103583371 | 3300018088 | Tropical Peatland | YVREKDKVRAVELLTTLRRDFPGNTLFPREIARLQAAH |
| Ga0187770_108194031 | 3300018090 | Tropical Peatland | IAYVRDKDRARALSMLTGLRQEFPANTLFPREIARLEIGSR |
| Ga0182025_11284853 | 3300019786 | Permafrost | ARVLLAIVYVREKNNSRALQLLAGLRRQFPANTLFPREIAHLQSER |
| Ga0193747_11321742 | 3300019885 | Soil | YVREKDKPRARELLASLRDDFPKNPLFAKEIARLDSGQ |
| Ga0193751_10840601 | 3300019888 | Soil | VRDKDKRRALQMLDGLRTEFPGNTLFPREIARLERAH |
| Ga0210407_100142971 | 3300020579 | Soil | VREKDKAQALEMLTGLRAEFPGNSLFAREIARLQSGG |
| Ga0210399_104700981 | 3300020581 | Soil | EKDNSRALQLLTGLRREFPANTLFSREIAHLQSAP |
| Ga0210399_115246441 | 3300020581 | Soil | APFARILLAIAYVREKDRPRALELLAGLQREFPGNTLFPREIAHLRAVH |
| Ga0210401_107137531 | 3300020583 | Soil | ARILLAIAYVRDKDNSRARELLASLRDEFPKNTLFTNEIARLDAGH |
| Ga0210406_104289291 | 3300021168 | Soil | AIAYVREKDKIRALQVLHDLHIEFPGNTLFPHEIARLQSPH |
| Ga0210405_109399111 | 3300021171 | Soil | AYVREKDKPRARELLASLRDEFPRNPLFAREIARLDAGQ |
| Ga0210388_104265141 | 3300021181 | Soil | ILLAIAYVREKDKAHALQLLTDLGREFPANTLFPREIAHLQALR |
| Ga0213874_103772792 | 3300021377 | Plant Roots | LLAIAYVRDHDKQHARELLLSLHDQFPSNPLFVREMARLDASR |
| Ga0210393_102428723 | 3300021401 | Soil | LAIAYVRERDKPRAVQLLTSLRDQYPANPLFAREISRLESSR |
| Ga0210385_101369443 | 3300021402 | Soil | LAIAYVREKNKSAAIQLLAGLHSEFPSNTLFPREIARLEAAH |
| Ga0210385_111308541 | 3300021402 | Soil | FARILLAIAYVRDKDKGRALQILTALRTQFPANTLFPQEIARLQNGH |
| Ga0210397_100699903 | 3300021403 | Soil | ARILLSIAYVREKNKAQALQLLTGLQSEFPANTLFPREIAHLQSTH |
| Ga0210389_106851191 | 3300021404 | Soil | RILLAIAYVREKDQARARQLLVSLRDQFPQNPLFGEEIARLDTRPGN |
| Ga0210383_100865413 | 3300021407 | Soil | IAYVRDKDKPHALELLSSLRTRFPGNTLFPREIDRLQSAH |
| Ga0210394_101681261 | 3300021420 | Soil | LAIAYVRDKDKSRARQLLVSLRDQFPQNPLFEQEIARLDTRPGN |
| Ga0210390_105988522 | 3300021474 | Soil | APFARILLAIAYVREKNKSAAIQLLAGLHREFPSNTLFPREIARLEAAH |
| Ga0210402_112961252 | 3300021478 | Soil | VARILLAIAYVRDKDTARARGVLASLRDEFPKNPLFAQEIARLDATH |
| Ga0210402_113561971 | 3300021478 | Soil | ARILLAIAYVREKDKPRARELLIGLRDQFPQNALFGEEIARLDGRP |
| Ga0210410_109521612 | 3300021479 | Soil | APLARILLSIAYVREKDKPRALELLTNLSRDFPENTLFSRQIAHLQSAR |
| Ga0210409_105998241 | 3300021559 | Soil | RILLAIAYVREKDKPRALRLLAGLQHDFPGNALFPREIARLQSAH |
| Ga0126371_123523752 | 3300021560 | Tropical Forest Soil | AIAYVRDKDNARSRQLLASLRDDFPGNPLFQRKLARSDSGH |
| Ga0242655_100018223 | 3300022532 | Soil | FARILLAIAYVREKDNSKALQLLAGLRRDFPENELFSREIAHLQAAH |
| Ga0212123_102460622 | 3300022557 | Iron-Sulfur Acid Spring | FARILLAIAYVREKDKPRARQLLISLRDQFPKNPLFEQEIARLDTWPAPDN |
| Ga0212123_102547352 | 3300022557 | Iron-Sulfur Acid Spring | FARILLSIAYVREKDKSRALQLLIGLRREFPANTLFSREIAHLQSSH |
| Ga0212128_100066151 | 3300022563 | Thermal Springs | LLAVAHLREKDIAQARALLTGLRDEFPANPLFARELARLEKDPSCKNC |
| Ga0224562_10136312 | 3300022733 | Soil | IAYVRDKDKPRAIQLLMGLRAQFPANPLFERELARLQPVP |
| Ga0233359_10464851 | 3300024049 | Soil | LSIAYVRDKNKIRALELLTALRAQFPENTLFPREIARLQPNFTK |
| Ga0247668_10288132 | 3300024331 | Soil | AIAYVREKDKARAIEILSSLETEFPENSLFPREISRLRASR |
| Ga0207684_112079072 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VRDHDRKHARELLASLRDEFPANPLFAQEIARLDAVH |
| Ga0207654_107285712 | 3300025911 | Corn Rhizosphere | ILLAIAYVRDHDKKHARELLASLRDEFPANPLFAQEIARLDEVH |
| Ga0207654_114079812 | 3300025911 | Corn Rhizosphere | IAYVRDHDKKRARELLAQLHDEFPANPLFPQEIARLDAGR |
| Ga0207671_103511561 | 3300025914 | Corn Rhizosphere | LLAIAYGRDHDKQHARQLLAQLHDEFPANPLFPQEMARLDKGR |
| Ga0207663_100024771 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VRDNDTAKARSVLASLRDEFPKNPLFAQEIAHLDSAK |
| Ga0207663_101127511 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | REKKKAHAIELLADLQREFPGNSLFPRQIAHLRSSQK |
| Ga0207663_110465762 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | APFANILLAIAYVRDHDKPHARELLASLRDQFPANPLFAQEIARLDAAR |
| Ga0207660_101138961 | 3300025917 | Corn Rhizosphere | LAIAYVRDHDKQRARQLLSQLHQEFPANPLFSQEMARLDAGR |
| Ga0207700_101626833 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LLAIAYVREHDKQHARQLLSQLHDEFPANPLFPQEMARLDKGK |
| Ga0207664_100064737 | 3300025929 | Agricultural Soil | ARILLSIAYVREKDKPRAMQLLTSLHAEFPDNTLFPREIAHLQAPR |
| Ga0207664_104649671 | 3300025929 | Agricultural Soil | DKDKTRAIELLAGLQKEFPGNSLFGREIAHLQAAR |
| Ga0207665_104539981 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LAIAYVRDHDKKHARELLASLRDEFPANPLFSQEIARLDESH |
| Ga0207667_116388382 | 3300025949 | Corn Rhizosphere | EHKRPEARALLASLQQEFPNNPLFAREIARLDSSR |
| Ga0207667_120513122 | 3300025949 | Corn Rhizosphere | FARILLAIAYVREKDKPSALTMLASLRDEFPKNPLFAREIARLDTRN |
| Ga0207677_110465141 | 3300026023 | Miscanthus Rhizosphere | RILLAIAYVREKDKGRALQLLAGLQREFPGNTLFPREIARLQATQ |
| Ga0207639_122985012 | 3300026041 | Corn Rhizosphere | PFARILLAIAYVREKDKGRALQLLAGLQREFPGNTLFPREIARLQATH |
| Ga0207641_103726402 | 3300026088 | Switchgrass Rhizosphere | YVRDKDNNKARELLANLRDEFPKNTLFPREIARLDAGH |
| Ga0207698_116679972 | 3300026142 | Corn Rhizosphere | LLAIAYVRDHDKQRARQLLSQLHQEFPANPLFSQEMARLDAGR |
| Ga0209863_100173702 | 3300026281 | Prmafrost Soil | REHDKTHARQLLASLRDQYPGNPLFAQEIARLDSGH |
| Ga0209863_101584651 | 3300026281 | Prmafrost Soil | VRDKDKSRARELLTGLRDEFPSNPLFVREIARLDSGH |
| Ga0209238_11842831 | 3300026301 | Grasslands Soil | RDHDKQHARELLASLEVQFPSNPLFAEEIAKLNSSH |
| Ga0209240_12442921 | 3300026304 | Grasslands Soil | VREKDRTRALQLLTGLRTEFPGNPLYGREIARLQTGH |
| Ga0209687_13068831 | 3300026322 | Soil | LAIAYVRDRDRGRAREVLIALRDEFPQSPLFAREIARLDATH |
| Ga0209803_11028381 | 3300026332 | Soil | AIAYVREKDKPHARELLSSLRDEFPNNPLFAREIARLDYGH |
| Ga0209803_13272721 | 3300026332 | Soil | RILLAIAYVREKDKRHARELLSSLREEFPNNPLFAREIARLDYGH |
| Ga0209161_105627372 | 3300026548 | Soil | RILLAIAYVREKDKPRAREILASLRDEFPKNPLFAREIARLDSIH |
| Ga0209648_106735972 | 3300026551 | Grasslands Soil | DHDKTHARELLASLRDQFPANPLFAQEIARLDAAR |
| Ga0209577_104403732 | 3300026552 | Soil | VREKDKPRARELLASLRDDFPKNPLFAKEIARLDSGQ |
| Ga0207727_1179892 | 3300026854 | Tropical Forest Soil | AYVREKDKARAVRLLSGLQSEFPRNTLFQRQIAHLQASH |
| Ga0209332_10392241 | 3300027439 | Forest Soil | RVLLAIAYVRDKNKPRAIELLTSLQAQFSGNTLFPREITRLQAAH |
| Ga0209525_10058661 | 3300027575 | Forest Soil | AVAYVREKDNSRALQLLTGLRSEFPANTLFPREIAHLRDAPQR |
| Ga0209003_10494801 | 3300027576 | Forest Soil | ILLAIAYVREKDKPRALEMLASLHDEFPNNSLFTREIARLEASR |
| Ga0209528_10575012 | 3300027610 | Forest Soil | RILLAIAYVRDKDNNRALQMLAGLRTEFPGNTLFPREIARLEQAR |
| Ga0209528_10789911 | 3300027610 | Forest Soil | RILLAIAYVRDKDNNRARELLASLRDEFPKNTLFTNEIARLDAGH |
| Ga0209117_11512241 | 3300027645 | Forest Soil | YVRDKDKPRALALLTSLRAQFPGNTLFPREIARLQTAH |
| Ga0209420_11186231 | 3300027648 | Forest Soil | ARILLAIAYVRDKDNPRALELLMALRTQFPGNTLFPREIARLTPSVTSAH |
| Ga0209420_11416662 | 3300027648 | Forest Soil | ILLAIAYVREKNKVRALELLSALRSQFPGNTVFPREIARLQAGH |
| Ga0209908_102426952 | 3300027745 | Thawing Permafrost | LKPFARILLAIAYVRDKDKTRALELLTALSIQFPGNTLFPREIARLTPSVTSAP |
| Ga0209139_102203542 | 3300027795 | Bog Forest Soil | ILLAIAYVRDKDNERALNVLKSLRTQFPANTLFPREIARLQNGH |
| Ga0209773_104041451 | 3300027829 | Bog Forest Soil | AIAYVREKDKSRARELLVSLRNDFPQNPLFAREIGRLDAQR |
| Ga0209166_100066521 | 3300027857 | Surface Soil | ILLAIAYTREKNKPRAIELLAGLQKEFPGNTLFARQIAHLQAGR |
| Ga0209701_101853672 | 3300027862 | Vadose Zone Soil | EKDRTRALQLLTGLRTEFPGNPLYGREIARLQTGH |
| Ga0209701_104746392 | 3300027862 | Vadose Zone Soil | VRDKDKPRARALLASLRDEFPNNPLFAREIARLDSGQ |
| Ga0209167_108156652 | 3300027867 | Surface Soil | GHYLKPFARILLAIAYVRDKDKERALEVLKSLRTQFPANTLFPREIARLQTAH |
| Ga0209488_101781323 | 3300027903 | Vadose Zone Soil | APFARVLLAIAYVRDKDKPRALELLTSLRAQFPNNTLFPREIIRLQASQ |
| Ga0209488_104796002 | 3300027903 | Vadose Zone Soil | REKDKPRARELLAALRDDFPKNPLFAREIARLDSGQ |
| Ga0209698_100130071 | 3300027911 | Watersheds | FARILLAIAYVREKDTARAREMLIGLRREFPENALFDKELARLDKTARR |
| Ga0209526_105288213 | 3300028047 | Forest Soil | LLAIAYVRDKDNVRARELLASLRDEFPKNTLFTNEIARLDAGH |
| Ga0302231_103518022 | 3300028775 | Palsa | ILLAIAYVRDKDNTRALVLLTSLRTQFPGNTLFPREIARLQPSVTSEH |
| Ga0307312_107610331 | 3300028828 | Soil | GPFARILLAIAYVRDKDNVRARELLASLRDEFPKNTLFTNEIARLDAGH |
| Ga0311339_102122203 | 3300029999 | Palsa | ILLAIAYVRDKNNPRALELLIGLRTQFPGNTLFPREIARLTPSVTSAH |
| Ga0302281_102658052 | 3300030044 | Fen | KPFARILLAIAYVRDKNKTRALELLVALRSQFPGNTLFPREIARLQPSVTK |
| Ga0302179_105365841 | 3300030058 | Palsa | PFARILLAIAYVRDKDKPRAIQLLIGLRAQFPANPLFARELVRLQPAP |
| Ga0302192_103942771 | 3300030507 | Bog | ILLAIAYVRDKDKTRALELLTSLRTQFPGNTLFPREIARLQPSVMAAH |
| Ga0302316_102980752 | 3300030646 | Palsa | PFARILLAIAYVRDKDNTRALVLLTSLRTQFPGNTLFPREIARLQPSVTSEH |
| Ga0310039_100865221 | 3300030706 | Peatlands Soil | ARILLAIAYVRDKDKSRALQLLTSLRSQFPGNTLFPREISRLQSAH |
| Ga0310039_104033112 | 3300030706 | Peatlands Soil | AYVREKDNPRALLLLEGLQIEFPSNALFSREITHLHAAR |
| Ga0170834_1065382112 | 3300031057 | Forest Soil | SIAYVREKDKPRAMQLLTSLHAEFPANAIFPREIAHLQAAH |
| Ga0170834_1066109891 | 3300031057 | Forest Soil | PFARVLLAIAYVRDKNKPRALELLASLRTQFPDNTLFPREITRLQAAR |
| Ga0310915_104484391 | 3300031573 | Soil | AIAYVREKDNPRAVELLSGLQREFPGNSLFPREIAHLRTSH |
| Ga0310686_1025475131 | 3300031708 | Soil | IAYVREKDNSRALQLLTGLRSEFPANTLFPREIAHLRDAPQR |
| Ga0310686_1111865221 | 3300031708 | Soil | ILLSIAYVRDKDKAGALQLLTALRTQFPANTLFPREIARLENGR |
| Ga0310686_1192333812 | 3300031708 | Soil | FARILLAIAYVRDKDKFRALQLLTSLRAQFPGNTLFPREISRLQSAH |
| Ga0307474_100873381 | 3300031718 | Hardwood Forest Soil | VREKDKSRALQLLTGLQQEFPGNTLFPREIAHLESSH |
| Ga0307477_100476233 | 3300031753 | Hardwood Forest Soil | EKDKPRALQLLTGLRSEFPSNTVFPREIARLQTAP |
| Ga0307475_104569851 | 3300031754 | Hardwood Forest Soil | ARVLLAIAYVRGKDKQHALELLASLRTQFPANPLFPREISRLQASIRSSTAP |
| Ga0307475_106601732 | 3300031754 | Hardwood Forest Soil | RILLAIACVREKDKPLARELLASLRDQFPANPLFPLEIARLDSH |
| Ga0214473_110399392 | 3300031949 | Soil | DNNRAQAREILLGLRDDFPSNPLFAREIARLDGDIN |
| Ga0306926_103738821 | 3300031954 | Soil | REHDKQHARQLLASLRDQFPANPLFAREIARLDSTR |
| Ga0307479_100320226 | 3300031962 | Hardwood Forest Soil | VREKDKSRALQLLASLHDEFPHNPLFPREMARLGSTAGF |
| Ga0307479_108177171 | 3300031962 | Hardwood Forest Soil | AYVREKDKPRALQLLAGLRAEFPGNPLFSRQMARLENRR |
| Ga0307479_112871522 | 3300031962 | Hardwood Forest Soil | LAIAYVREKDKPQARELLASLRGQFPANPLFPLEIARLDSR |
| Ga0307479_115652642 | 3300031962 | Hardwood Forest Soil | PRTPSARIQLAIAYVRDKNKPRALELLSSLRTDFPGNTLFAREIIRLQSVH |
| Ga0307479_118074872 | 3300031962 | Hardwood Forest Soil | SIAYVREKDKPQARELLASLRDQFPANPLFPLEIARLDSH |
| Ga0306922_111159672 | 3300032001 | Soil | LLAIAYVREKDKPQAVELLSELQREFPGNPLFPRQIEHLQRSH |
| Ga0307471_1006594671 | 3300032180 | Hardwood Forest Soil | ARMMLAIAYVREKDKPKARSLLASLRDEFPENPLFALEIARLDAAH |
| Ga0307471_1030135861 | 3300032180 | Hardwood Forest Soil | PFARILLAIVYVREKDKPRALQLLTGLRSEFPANTLFPREIARLQTGP |
| Ga0307471_1035048652 | 3300032180 | Hardwood Forest Soil | PFARMLLAIAYVREKDKPRARELLASLRDEFPRNPLFAREIERLDAGQ |
| Ga0307472_1006644182 | 3300032205 | Hardwood Forest Soil | YMAPFARILLAIAYVREKDRARALELLTGLQHEFPGNTLFPREIAHLRAVH |
| Ga0307472_1008543663 | 3300032205 | Hardwood Forest Soil | LAIAYVREKDKPKARSLLASLRDEFPENPLFALEIARLDAGH |
| Ga0335085_115279841 | 3300032770 | Soil | ARILLSIAYVREKDDLRALQLLTGLQREFPGNALFSREIARLQTTR |
| Ga0335079_112827221 | 3300032783 | Soil | YVRDHDKQRAVELLASLRNEFPANPLFAQEIARLDSSQ |
| Ga0335078_118084261 | 3300032805 | Soil | REKDDLRALQLLTGLQREFPGNALFSREIARLQTTR |
| Ga0335080_117308651 | 3300032828 | Soil | LREKDKGRARDLLVSLRNDFPENPLFAREIGRLDSQR |
| Ga0335075_115083321 | 3300032896 | Soil | ARILLAIAYVRDRNKQRALDVLSALRSEFPRNTLFPKEIARLESGH |
| Ga0335071_117930682 | 3300032897 | Soil | ILLAIAYVREKDKSHALQLLTGLQRDFPSNALFPREIARLEASH |
| Ga0335072_110522182 | 3300032898 | Soil | IAYVREKDKPRAIEILTSLRSDFPANPLFGREIARLQSGQ |
| Ga0335076_100813673 | 3300032955 | Soil | YVREKDKGKALELLAGLRRDFPGNTLFPREIAHLQASH |
| Ga0310810_101754923 | 3300033412 | Soil | ARILLSIAYVRDKDKTRAIELLAGLQKEFPGNSLFGREIAHLRAAR |
| Ga0214471_114283971 | 3300033417 | Soil | APYARILLAIASLRDDDRTQARSLLVGLRDDFPSNLLFAREIARIDGATN |
| Ga0334854_156809_428_553 | 3300033829 | Soil | AIAYVREKDKPRARETLTGLRAEFPANLLFAREIGRLDAKP |
| ⦗Top⦘ |