NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F013830

Metagenome / Metatranscriptome Family F013830

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F013830
Family Type Metagenome / Metatranscriptome
Number of Sequences 268
Average Sequence Length 43 residues
Representative Sequence LAIAYVREKDKPHARELLSSLRDEFPNNPLFAREIARLDYGH
Number of Associated Samples 220
Number of Associated Scaffolds 268

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 87.31 %
Associated GOLD sequencing projects 201
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.239 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(8.582 % of family members)
Environment Ontology (ENVO) Unclassified
(18.657 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.507 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.57%    β-sheet: 0.00%    Coil/Unstructured: 51.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 268 Family Scaffolds
PF12849PBP_like_2 66.04
PF13089PP_kinase_N 9.33
PF13090PP_kinase_C 2.61
PF02541Ppx-GppA 1.49
PF01925TauE 1.12
PF03167UDG 1.12
PF13565HTH_32 1.12
PF14559TPR_19 0.75
PF02687FtsX 0.75
PF09907HigB_toxin 0.75
PF00300His_Phos_1 0.37
PF02353CMAS 0.37
PF13358DDE_3 0.37
PF01551Peptidase_M23 0.37
PF16976RcpC 0.37
PF08448PAS_4 0.37
PF04264YceI 0.37
PF13620CarboxypepD_reg 0.37
PF00195Chal_sti_synt_N 0.37
PF03781FGE-sulfatase 0.37
PF13472Lipase_GDSL_2 0.37
PF13493DUF4118 0.37
PF01112Asparaginase_2 0.37
PF03551PadR 0.37

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 268 Family Scaffolds
COG0248Exopolyphosphatase/pppGpp-phosphohydrolaseSignal transduction mechanisms [T] 2.99
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 1.12
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 1.12
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 1.12
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 1.12
COG03323-oxoacyl-[acyl-carrier-protein] synthase IIILipid transport and metabolism [I] 0.37
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.37
COG1446Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamilyAmino acid transport and metabolism [E] 0.37
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.37
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.37
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.37
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.37
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.37
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 0.37
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.37
COG3424Predicted naringenin-chalcone synthaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.24 %
UnclassifiedrootN/A22.76 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001174|JGI12679J13547_1000476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1790Open in IMG/M
3300001175|JGI12649J13570_1016709Not Available809Open in IMG/M
3300001867|JGI12627J18819_10500006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia500Open in IMG/M
3300002245|JGIcombinedJ26739_100800232All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia823Open in IMG/M
3300002245|JGIcombinedJ26739_101706606All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300002560|JGI25383J37093_10031100All Organisms → cellular organisms → Bacteria → Acidobacteria1786Open in IMG/M
3300004091|Ga0062387_100893629All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter671Open in IMG/M
3300004633|Ga0066395_10172094All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1114Open in IMG/M
3300005171|Ga0066677_10824042All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005179|Ga0066684_10614782All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300005332|Ga0066388_106012838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter613Open in IMG/M
3300005337|Ga0070682_101504729All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter579Open in IMG/M
3300005340|Ga0070689_100101639All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2276Open in IMG/M
3300005345|Ga0070692_10190636All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1194Open in IMG/M
3300005435|Ga0070714_100043096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3815Open in IMG/M
3300005435|Ga0070714_101720761Not Available612Open in IMG/M
3300005439|Ga0070711_100133641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1851Open in IMG/M
3300005446|Ga0066686_10820672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300005451|Ga0066681_10453945All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300005455|Ga0070663_102004201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter521Open in IMG/M
3300005456|Ga0070678_101133198All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300005468|Ga0070707_100983148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter809Open in IMG/M
3300005534|Ga0070735_10335797All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium908Open in IMG/M
3300005537|Ga0070730_10010117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter7765Open in IMG/M
3300005541|Ga0070733_10195790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1320Open in IMG/M
3300005542|Ga0070732_10345291All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300005544|Ga0070686_101888537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter509Open in IMG/M
3300005553|Ga0066695_10462991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter781Open in IMG/M
3300005569|Ga0066705_10224743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1184Open in IMG/M
3300005610|Ga0070763_10827493All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300005719|Ga0068861_100774566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter898Open in IMG/M
3300005841|Ga0068863_100248815All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1717Open in IMG/M
3300005842|Ga0068858_100077133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3095Open in IMG/M
3300005993|Ga0080027_10009084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3593Open in IMG/M
3300006028|Ga0070717_11923513All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300006028|Ga0070717_12082023Not Available511Open in IMG/M
3300006052|Ga0075029_100366616Not Available931Open in IMG/M
3300006059|Ga0075017_101667300Not Available504Open in IMG/M
3300006102|Ga0075015_100636709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae627Open in IMG/M
3300006162|Ga0075030_100438696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1040Open in IMG/M
3300006162|Ga0075030_100810428All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae739Open in IMG/M
3300006162|Ga0075030_101082156Not Available631Open in IMG/M
3300006163|Ga0070715_10119186Not Available1256Open in IMG/M
3300006173|Ga0070716_101171212All Organisms → cellular organisms → Bacteria → Acidobacteria616Open in IMG/M
3300006173|Ga0070716_101281066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300006174|Ga0075014_100052175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1760Open in IMG/M
3300006175|Ga0070712_100753977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium833Open in IMG/M
3300006354|Ga0075021_10047467All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2477Open in IMG/M
3300006800|Ga0066660_10338052All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1217Open in IMG/M
3300006806|Ga0079220_11272938All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300006871|Ga0075434_100710079Not Available1023Open in IMG/M
3300006871|Ga0075434_101786409Not Available622Open in IMG/M
3300006893|Ga0073928_10060369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3353Open in IMG/M
3300006903|Ga0075426_11380983Not Available535Open in IMG/M
3300006954|Ga0079219_11914147Not Available560Open in IMG/M
3300007076|Ga0075435_101727009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae549Open in IMG/M
3300007982|Ga0102924_1119928All Organisms → cellular organisms → Bacteria → Acidobacteria1278Open in IMG/M
3300009088|Ga0099830_11400719Not Available582Open in IMG/M
3300009137|Ga0066709_102480459All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium700Open in IMG/M
3300009137|Ga0066709_103069703All Organisms → cellular organisms → Bacteria → Acidobacteria611Open in IMG/M
3300009137|Ga0066709_104354369All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300009143|Ga0099792_10601122All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300009174|Ga0105241_11220028All Organisms → cellular organisms → Bacteria → Acidobacteria713Open in IMG/M
3300009520|Ga0116214_1154908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium854Open in IMG/M
3300009524|Ga0116225_1560893All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium505Open in IMG/M
3300009549|Ga0116137_1042518All Organisms → cellular organisms → Bacteria1518Open in IMG/M
3300009551|Ga0105238_10806369All Organisms → cellular organisms → Bacteria → Acidobacteria954Open in IMG/M
3300009551|Ga0105238_11848334All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300009551|Ga0105238_12390063All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300009618|Ga0116127_1057732Not Available1098Open in IMG/M
3300009618|Ga0116127_1156330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300009637|Ga0116118_1047666All Organisms → cellular organisms → Bacteria1529Open in IMG/M
3300009698|Ga0116216_10717853All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300009700|Ga0116217_10662800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300009700|Ga0116217_10851340Not Available560Open in IMG/M
3300009792|Ga0126374_10714641All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium755Open in IMG/M
3300009824|Ga0116219_10155848Not Available1319Open in IMG/M
3300010046|Ga0126384_11231821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300010358|Ga0126370_11794210Not Available593Open in IMG/M
3300010358|Ga0126370_12427251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300010359|Ga0126376_10536563Not Available1092Open in IMG/M
3300010360|Ga0126372_12475270All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300010360|Ga0126372_13160718Not Available512Open in IMG/M
3300010362|Ga0126377_13620147Not Available500Open in IMG/M
3300010366|Ga0126379_13830135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300010371|Ga0134125_10302537All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1776Open in IMG/M
3300010373|Ga0134128_10404938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.1523Open in IMG/M
3300010375|Ga0105239_11262512Not Available852Open in IMG/M
3300010379|Ga0136449_101608741All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium986Open in IMG/M
3300010379|Ga0136449_102003028Not Available855Open in IMG/M
3300010397|Ga0134124_10041971All Organisms → cellular organisms → Bacteria → Acidobacteria3829Open in IMG/M
3300010397|Ga0134124_10659308All Organisms → cellular organisms → Bacteria → Acidobacteria1031Open in IMG/M
3300010937|Ga0137776_1552449All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium500Open in IMG/M
3300011269|Ga0137392_10341621All Organisms → cellular organisms → Bacteria → Acidobacteria1240Open in IMG/M
3300012096|Ga0137389_10341535Not Available1273Open in IMG/M
3300012205|Ga0137362_11731254All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012206|Ga0137380_11161969All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300012209|Ga0137379_11761393All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300012211|Ga0137377_11833161All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012212|Ga0150985_114153769All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300012350|Ga0137372_11232422All Organisms → cellular organisms → Bacteria → Acidobacteria503Open in IMG/M
3300012354|Ga0137366_10003988All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis11509Open in IMG/M
3300012354|Ga0137366_11132051All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300012359|Ga0137385_11073808All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300012469|Ga0150984_104743079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1988Open in IMG/M
3300012500|Ga0157314_1021509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300012923|Ga0137359_10839555All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp.794Open in IMG/M
3300012929|Ga0137404_10873765All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium819Open in IMG/M
3300012955|Ga0164298_10437182All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300012960|Ga0164301_11590159All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300012960|Ga0164301_11614745All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300012961|Ga0164302_11464766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis561Open in IMG/M
3300012975|Ga0134110_10227755All Organisms → cellular organisms → Bacteria → Acidobacteria789Open in IMG/M
3300012986|Ga0164304_10460375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium919Open in IMG/M
3300013307|Ga0157372_10726581All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1155Open in IMG/M
3300014157|Ga0134078_10260635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300014501|Ga0182024_10306565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2096Open in IMG/M
3300014655|Ga0181516_10005967All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7401Open in IMG/M
3300015261|Ga0182006_1018691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2924Open in IMG/M
3300015262|Ga0182007_10120672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300015373|Ga0132257_101190438Not Available964Open in IMG/M
3300016404|Ga0182037_11809334All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300016445|Ga0182038_11034494All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300017823|Ga0187818_10107756Not Available1206Open in IMG/M
3300017927|Ga0187824_10318155All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300017933|Ga0187801_10024357All Organisms → cellular organisms → Bacteria → Acidobacteria2083Open in IMG/M
3300017935|Ga0187848_10047661All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300017940|Ga0187853_10345618Not Available665Open in IMG/M
3300017943|Ga0187819_10188173All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300017955|Ga0187817_10566690All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300017961|Ga0187778_10254127All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300017966|Ga0187776_10026293All Organisms → cellular organisms → Bacteria3211Open in IMG/M
3300017970|Ga0187783_10835492Not Available664Open in IMG/M
3300017970|Ga0187783_10949109All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300017974|Ga0187777_10876595Not Available644Open in IMG/M
3300017975|Ga0187782_10207809All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300017999|Ga0187767_10092845All Organisms → cellular organisms → Bacteria → Acidobacteria827Open in IMG/M
3300018013|Ga0187873_1055512Not Available1692Open in IMG/M
3300018034|Ga0187863_10400877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis765Open in IMG/M
3300018058|Ga0187766_10847682All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300018062|Ga0187784_10788734All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300018082|Ga0184639_10257457All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M
3300018086|Ga0187769_10601182All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300018086|Ga0187769_10662511All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300018088|Ga0187771_10358337Not Available1227Open in IMG/M
3300018090|Ga0187770_10819403Not Available745Open in IMG/M
3300019786|Ga0182025_1128485Not Available1661Open in IMG/M
3300019885|Ga0193747_1132174Not Available582Open in IMG/M
3300019888|Ga0193751_1084060Not Available1263Open in IMG/M
3300020579|Ga0210407_10014297All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5899Open in IMG/M
3300020581|Ga0210399_10470098Not Available1046Open in IMG/M
3300020581|Ga0210399_11524644All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium518Open in IMG/M
3300020583|Ga0210401_10713753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium863Open in IMG/M
3300021168|Ga0210406_10428929Not Available1055Open in IMG/M
3300021171|Ga0210405_10939911All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300021181|Ga0210388_10426514Not Available1165Open in IMG/M
3300021377|Ga0213874_10377279All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300021401|Ga0210393_10242872All Organisms → cellular organisms → Bacteria → Acidobacteria1460Open in IMG/M
3300021402|Ga0210385_10136944Not Available1741Open in IMG/M
3300021402|Ga0210385_11130854Not Available601Open in IMG/M
3300021403|Ga0210397_10069990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2297Open in IMG/M
3300021404|Ga0210389_10685119All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium803Open in IMG/M
3300021407|Ga0210383_10086541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2627Open in IMG/M
3300021420|Ga0210394_10168126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1908Open in IMG/M
3300021474|Ga0210390_10598852All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium924Open in IMG/M
3300021478|Ga0210402_11296125All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300021478|Ga0210402_11356197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis638Open in IMG/M
3300021479|Ga0210410_10952161All Organisms → cellular organisms → Bacteria747Open in IMG/M
3300021559|Ga0210409_10599824All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium970Open in IMG/M
3300021560|Ga0126371_12352375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300022532|Ga0242655_10001822All Organisms → cellular organisms → Bacteria3091Open in IMG/M
3300022557|Ga0212123_10246062All Organisms → cellular organisms → Bacteria → Acidobacteria1287Open in IMG/M
3300022557|Ga0212123_10254735Not Available1257Open in IMG/M
3300022563|Ga0212128_10006615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7551Open in IMG/M
3300022733|Ga0224562_1013631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300024049|Ga0233359_1046485Not Available512Open in IMG/M
3300024331|Ga0247668_1028813Not Available1141Open in IMG/M
3300025910|Ga0207684_11207907All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300025911|Ga0207654_10728571All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300025911|Ga0207654_11407981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300025914|Ga0207671_10351156All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300025916|Ga0207663_10002477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8894Open in IMG/M
3300025916|Ga0207663_10112751All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1848Open in IMG/M
3300025916|Ga0207663_11046576All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300025917|Ga0207660_10113896All Organisms → cellular organisms → Bacteria2039Open in IMG/M
3300025928|Ga0207700_10162683All Organisms → cellular organisms → Bacteria1855Open in IMG/M
3300025929|Ga0207664_10006473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8059Open in IMG/M
3300025929|Ga0207664_10464967Not Available1130Open in IMG/M
3300025939|Ga0207665_10453998All Organisms → cellular organisms → Bacteria → Acidobacteria984Open in IMG/M
3300025949|Ga0207667_11638838Not Available611Open in IMG/M
3300025949|Ga0207667_12051312Not Available531Open in IMG/M
3300026023|Ga0207677_11046514All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium742Open in IMG/M
3300026041|Ga0207639_12298501All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium501Open in IMG/M
3300026088|Ga0207641_10372640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1365Open in IMG/M
3300026142|Ga0207698_11667997All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300026281|Ga0209863_10017370All Organisms → cellular organisms → Bacteria → Acidobacteria2229Open in IMG/M
3300026281|Ga0209863_10158465All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300026301|Ga0209238_1184283All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300026304|Ga0209240_1244292All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300026322|Ga0209687_1306883Not Available505Open in IMG/M
3300026332|Ga0209803_1102838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1165Open in IMG/M
3300026332|Ga0209803_1327272All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae528Open in IMG/M
3300026548|Ga0209161_10562737Not Available509Open in IMG/M
3300026551|Ga0209648_10673597All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300026552|Ga0209577_10440373Not Available914Open in IMG/M
3300026854|Ga0207727_117989All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300027439|Ga0209332_1039224All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium883Open in IMG/M
3300027575|Ga0209525_1005866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2845Open in IMG/M
3300027576|Ga0209003_1049480All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300027610|Ga0209528_1057501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium861Open in IMG/M
3300027610|Ga0209528_1078991All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium728Open in IMG/M
3300027645|Ga0209117_1151224All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300027648|Ga0209420_1118623All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300027648|Ga0209420_1141666All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300027745|Ga0209908_10242695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis506Open in IMG/M
3300027795|Ga0209139_10220354All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300027829|Ga0209773_10404145Not Available566Open in IMG/M
3300027857|Ga0209166_10006652All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7769Open in IMG/M
3300027862|Ga0209701_10185367Not Available1249Open in IMG/M
3300027862|Ga0209701_10474639All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300027867|Ga0209167_10815665All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae508Open in IMG/M
3300027903|Ga0209488_10178132All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1605Open in IMG/M
3300027903|Ga0209488_10479600Not Available913Open in IMG/M
3300027911|Ga0209698_10013007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis8233Open in IMG/M
3300028047|Ga0209526_10528821All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300028775|Ga0302231_10351802All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300028828|Ga0307312_10761033Not Available642Open in IMG/M
3300029999|Ga0311339_10212220All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2174Open in IMG/M
3300030044|Ga0302281_10265805Not Available694Open in IMG/M
3300030058|Ga0302179_10536584Not Available513Open in IMG/M
3300030507|Ga0302192_10394277Not Available567Open in IMG/M
3300030646|Ga0302316_10298075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300030706|Ga0310039_10086522Not Available1327Open in IMG/M
3300030706|Ga0310039_10403311All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300031057|Ga0170834_106538211All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031057|Ga0170834_106610989All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1889Open in IMG/M
3300031573|Ga0310915_10448439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium917Open in IMG/M
3300031708|Ga0310686_102547513All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium545Open in IMG/M
3300031708|Ga0310686_111186522Not Available2871Open in IMG/M
3300031708|Ga0310686_119233381All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300031718|Ga0307474_10087338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2325Open in IMG/M
3300031753|Ga0307477_10047623All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2946Open in IMG/M
3300031754|Ga0307475_10456985Not Available1026Open in IMG/M
3300031754|Ga0307475_10660173All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300031949|Ga0214473_11039939All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300031954|Ga0306926_10373882All Organisms → cellular organisms → Bacteria → Acidobacteria1761Open in IMG/M
3300031962|Ga0307479_10032022All Organisms → cellular organisms → Bacteria → Acidobacteria5014Open in IMG/M
3300031962|Ga0307479_10817717Not Available907Open in IMG/M
3300031962|Ga0307479_11287152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300031962|Ga0307479_11565264Not Available615Open in IMG/M
3300031962|Ga0307479_11807487All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300032001|Ga0306922_11115967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300032180|Ga0307471_100659467All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300032180|Ga0307471_103013586All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300032180|Ga0307471_103504865All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300032205|Ga0307472_100664418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis931Open in IMG/M
3300032205|Ga0307472_100854366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria838Open in IMG/M
3300032770|Ga0335085_11527984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300032783|Ga0335079_11282722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300032805|Ga0335078_11808426All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300032828|Ga0335080_11730865Not Available612Open in IMG/M
3300032896|Ga0335075_11508332All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300032897|Ga0335071_11793068Not Available558Open in IMG/M
3300032898|Ga0335072_11052218All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300032955|Ga0335076_10081367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3177Open in IMG/M
3300033412|Ga0310810_10175492All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2456Open in IMG/M
3300033417|Ga0214471_11428397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300033829|Ga0334854_156809All Organisms → cellular organisms → Bacteria553Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.58%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.22%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.22%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.10%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.73%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.73%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.36%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.61%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.24%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.49%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.49%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.49%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.49%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.49%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.49%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.12%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.12%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.12%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.75%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.75%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.75%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.75%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.75%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.75%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.75%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.75%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.37%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.37%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.37%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.37%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.37%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.37%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.37%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.37%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.37%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.37%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.37%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.37%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.37%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.37%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.37%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001174Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1EnvironmentalOpen in IMG/M
3300001175Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cmEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012500Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610Host-AssociatedOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300022733Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3EnvironmentalOpen in IMG/M
3300024049Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026281Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026854Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes)EnvironmentalOpen in IMG/M
3300027439Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12679J13547_100047633300001174Forest SoilEKDKSRALQLLTGLRQDFPGNTLFPREIAHLQSSH*
JGI12649J13570_101670923300001175Forest SoilLAIAYVREKNKVRALELLSALRSQFPGNTVFPREIARLQAGH*
JGI12627J18819_1050000613300001867Forest SoilAYVREKDKPRAREMLASLRDDFPKNPLFAREIARLDSLH*
JGIcombinedJ26739_10080023213300002245Forest SoilLLAIAYVRDKDKSRALQMLAGLRTEFPGNTLFPREIARLEQAR*
JGIcombinedJ26739_10170660613300002245Forest SoilKDRTRALQLLSGLRTEFPGNPLYGREIARLQMGH*
JGI25383J37093_1003110013300002560Grasslands SoilIAYVREKDQPRAREMLASLRDEFPKNPLFAREIARLDNLR*
Ga0062387_10089362913300004091Bog Forest SoilILLAIAYVRDKDNERALNVLKSLRTQFPANTLFPREIARLQNGH*
Ga0066395_1017209423300004633Tropical Forest SoilLAIAYVREKDKARAIELLASLRDEFPTNPLFQNELARLNTGP*
Ga0066677_1082404213300005171SoilNILLAIAYVRDHDKKHARELLASLRDEFPANPLFAQEIAKLDAVH*
Ga0066684_1061478223300005179SoilAYVREKDKPRALELLSGLEREFPSNTLFPREIARLQSAH*
Ga0066388_10601283823300005332Tropical Forest SoilIAYVREKDTAKAQELLASLRDQYPKNPLFAREIARLQAQ*
Ga0070682_10150472923300005337Corn RhizosphereILLAIAYVRDKDNARARAVLATLRDEFPKNPLFAREIARLDAGH*
Ga0070689_10010163913300005340Switchgrass RhizosphereFARILLAIAYVRDKDNGRAREVLAALRDEFPKNPLFAREIARLDAGH*
Ga0070692_1019063623300005345Corn, Switchgrass And Miscanthus RhizosphereLGPFARILLAIAYVRDKDNGRAREVLAALRDEFPKNPLFAREIARLDAGH*
Ga0070714_10004309613300005435Agricultural SoilAYVREKDKPRAMQLLTSLHAEFPDNTLFPREIAHLQAPR*
Ga0070714_10172076113300005435Agricultural SoilAYVREKDKPRAVELLSGLQREFPGNTLFPRQIEHLQRSR*
Ga0070711_10013364113300005439Corn, Switchgrass And Miscanthus RhizosphereILLSIAYVREKKKAHAIELLADLQREFPGNSLFPRQIAHLRSSQK*
Ga0066686_1082067223300005446SoilLAIAYVRDHDKAHARELLGSLREQFPANPLFEQEIARLDAAR*
Ga0066681_1045394523300005451SoilARMLLAVTYLRDKDTRHARELLSGLRDEFPANPLFAREVARIDHNHGGQ*
Ga0070663_10200420113300005455Corn RhizosphereILLAIAYVREHDKPQARALLASLQQEFPNNTLFAREIARIDSAR*
Ga0070678_10113319823300005456Miscanthus RhizosphereLLAIAYVRDHDKQSARQLLSRLHEEFPANPLFSQEMARLDTAH*
Ga0070707_10098314823300005468Corn, Switchgrass And Miscanthus RhizosphereILLAIAYVRDKNKTRALELLMALRTQFPGNTLFPREIARLQPSITIAK*
Ga0070735_1033579713300005534Surface SoilYVRDKNKDRALELLNSLRADFPGNTLFPREIGRLQSQVSR*
Ga0070730_1001011713300005537Surface SoilLLAIAYTREKNKPRAIELLAGLQKEFPGNTLFARQIAHLQAGR*
Ga0070733_1019579023300005541Surface SoilRILLSIAYVREKEKSRALELLSGLQHEFPANTLFPREIAHLQSSR*
Ga0070732_1034529123300005542Surface SoilRILLAIAYVREKNKPRALELLAGLQREFPGNTLFPREIAHLRTVH*
Ga0070686_10188853713300005544Switchgrass RhizosphereLLAIAYVRDHDKQRARQLLSQLHQEFPANPLFSQEMARLDAGR*
Ga0066695_1046299113300005553SoilILLAVAYVREHDNQHARELLASLRDRFPANPLFAQEIARLDSNK*
Ga0066705_1022474333300005569SoilAYVREKDKPHARELLSSLRDEFPNNPLFAREIARLDYGH*
Ga0070763_1082749323300005610SoilLSIAYVRDENKIRALELLMALRAQFPGNTLFPREIARLQPNVSK*
Ga0068861_10077456623300005719Switchgrass RhizosphereIAYVREKDKPKAREVLSSLRDEFPNNPLFAREISRLDTGN*
Ga0068863_10024881513300005841Switchgrass RhizosphereEHDKPQARALLASLQQEFPNNTLFAREIARIDSAR*
Ga0068858_10007713333300005842Switchgrass RhizosphereYVRDKDNGRAREVLAALRDEFPKNPLFAREIARLDSGH*
Ga0080027_1000908413300005993Prmafrost SoilEHDKTHARQLLASLRDQYPGNPLFAQEIARLDSGH*
Ga0070717_1192351313300006028Corn, Switchgrass And Miscanthus RhizosphereDILLAIAYVREHDKQHARQLLSQLHDEFPANPLFPQEMARLDKGK*
Ga0070717_1208202323300006028Corn, Switchgrass And Miscanthus RhizosphereIAYVREKDKRRAMQLLTNLHNQFPANTLFPREIAHLQAAR*
Ga0075029_10036661623300006052WatershedsYVREKDKSRAIELLAGLRAEYPANPLFDREISRLESSH*
Ga0075017_10166730013300006059WatershedsLAIAYVRDKDNARARDLLAHLRDEFPKNTLFPREIARLDAGH*
Ga0075015_10063670913300006102WatershedsFARILLAIAYVRDKDNPHARGVLAALRDEFPKNPLFAREIARLDAMH*
Ga0075030_10043869623300006162WatershedsLAIAYVREKDKPRARDLLVALRDEFPSNPLFAQEIARLSTQPLSGNQP*
Ga0075030_10081042813300006162WatershedsPFARILLAIAYVREKDRPRALELLAGLQRAFPGSTLFPREIAHLRAAH*
Ga0075030_10108215623300006162WatershedsLLSIAYVREKDRARALELLAGLQREFPGNTLFPREIAHLRAAH*
Ga0070715_1011918613300006163Corn, Switchgrass And Miscanthus RhizosphereIAYVRDKDNVRARELLASLRDEFPKNTLFTNEIARLDAGH*
Ga0070716_10117121223300006173Corn, Switchgrass And Miscanthus RhizosphereVRDHDKKHARELLASLRDEFPANPLFSQEIARLDESH*
Ga0070716_10128106623300006173Corn, Switchgrass And Miscanthus RhizosphereYVREKDKPRAREMLASLRDDFPKNPLFAREIARLDSLH*
Ga0075014_10005217513300006174WatershedsARILLAIAYVRDKDKPRALQLLTGLRREFPGNTLFPREIAHLQAAHEVHQK*
Ga0070712_10075397713300006175Corn, Switchgrass And Miscanthus RhizosphereKDNNKARELLANLRDEFPKNTLFPREIARLDAGH*
Ga0075021_1004746743300006354WatershedsLLAIAYVREKDKPRARELLVSLRDEFPQNLLFTQEIARLDTQPLSGNRP*
Ga0066660_1033805213300006800SoilVREKDKSSALQMMAGLQRDFPGNTLFPREIANLQSGR*
Ga0079220_1127293813300006806Agricultural SoilNILLAIAYVRDHDKKHARELLASLRDEFPANPLFSQEIARLDESH*
Ga0075434_10071007913300006871Populus RhizosphereIAFVRDKDNARARGVLAALRDEFPRNPLFAREIARLDAIH*
Ga0075434_10178640913300006871Populus RhizosphereIAYVREKDKPSALTMLASLRDEFPKNPLFAREIARLDTRN*
Ga0073928_1006036913300006893Iron-Sulfur Acid SpringPLARILLAIAYVREKDNSRALQLLTGLRSEFPANTLFPREIAHLRDAPQR*
Ga0075426_1138098323300006903Populus RhizosphereREKDKPRALELLGGLRREFPGNSLFPREIAHLEASR*
Ga0079219_1191414713300006954Agricultural SoilIAYVREKNRPRAIALLSGLEQDFPGNSLFPREIEHLRSAR*
Ga0075435_10172700913300007076Populus RhizosphereIAYVREKDTARAQELLASLRDQYPKNPLFAREIARLQAQ*
Ga0102924_111992823300007982Iron-Sulfur Acid SpringFARILLAIAYVREKDKPRARQLLISLRDQFPKNPLFEQEIARLDTWPAPDN*
Ga0099830_1140071913300009088Vadose Zone SoilRILLAIAYVRDKDNNRARELLASLRDEFPKNTLFTNEIARLDAGH*
Ga0066709_10248045923300009137Grasslands SoilAYVREKDRPRALELLAGLQREFPGNTLFPREIAHLRAVH*
Ga0066709_10306970313300009137Grasslands SoilIAYVRDHDKKHARELLASLRDEFPANPLFAQEIAKLDAVH*
Ga0066709_10435436913300009137Grasslands SoilRILLAIAYVREKDQPRAREMLASLRDEFPKNPLFAREIAHLDNLR*
Ga0099792_1060112213300009143Vadose Zone SoilARVLLAIAYVRDKDKPRALELLTSLRAQFPNNTLFPREIIRLQASQ*
Ga0105241_1122002813300009174Corn RhizosphereILLAIAYVRDHDKKHARELLASLRDEFPANPLFAQEIARLDEVH*
Ga0116214_115490823300009520Peatlands SoilARILLAIAYVREKDKMRARELLVSLRNEFPQNPLFAQEIARLDTQPGSGDRP*
Ga0116225_156089323300009524Peatlands SoilAIAYVRDKDKSRALQLLTSLRSQFPGNTLFPREISRLQSAH*
Ga0116137_104251823300009549PeatlandARILLAIAYVRDNNKPRALELLASLRSEFPGNTLFPREIARLQTSISIPK*
Ga0105238_1080636923300009551Corn RhizosphereLLAIAYVRDHDKKHARELLASLRDEFPANPLFSQEIARLDESH*
Ga0105238_1184833413300009551Corn RhizosphereVRDHDKQRARELLAALRTEFPTNPLFGQEIARLDSGQ*
Ga0105238_1239006323300009551Corn RhizosphereAPFADILLAIAYVRDHDKQRARQLLSQLHQEFPANPLFSQEMARLDAGR*
Ga0116127_105773223300009618PeatlandILLAIAYVRDKNKPRALELLASLRSEFPGNTLFPREIARLRTSH*
Ga0116127_115633023300009618PeatlandILLAIAYVRDKNKPRALELLASLRSEFPGNTLFPREIARLQTSISIPK*
Ga0116118_104766613300009637PeatlandFARILLAIAYVRDKNKPRALELLASLRSEFPGNTLFPREIARLQTSISIPK*
Ga0116216_1071785313300009698Peatlands SoilYVREKDKPRALQMLAGLRLEFPGNTLFAREIAHLQAAK*
Ga0116217_1066280013300009700Peatlands SoilAPFARILLAIAYLRDNDRPRAIQLLIGLRAEFPANPLFSREIARLQPAP*
Ga0116217_1085134013300009700Peatlands SoilLLAIAYVRDKDKVRALELLTALRTQFPGNTLFPREIARLTPSVTAAH*
Ga0126374_1071464123300009792Tropical Forest SoilFANILLAIAYVREHDKQHARELLASLRDHYPKNPLFGRELARLDSAR*
Ga0116219_1015584813300009824Peatlands SoilRILLAIAYVRDKDKSRALQLLTSLRSQFPGNTLFPREISRLQSAH*
Ga0126384_1123182123300010046Tropical Forest SoilFARILLAIAYVREKDTVKARELLAGLRDQYPKNPLFAREIARLQAH*
Ga0126370_1179421023300010358Tropical Forest SoilRILLAIAYVRDKDKPKAREVLTSLRNEFPNNPLFAREIARPDSSNP*
Ga0126370_1242725113300010358Tropical Forest SoilAHILLAIAYVREQDKPHAREILTSLHQQFPANPLFAQEIAKLDGKR*
Ga0126376_1053656313300010359Tropical Forest SoilILLSIAYVREKNNEMALEVLTALQREFPGNPLFSREISRLRATVRSR*
Ga0126372_1247527023300010360Tropical Forest SoilAIAYVREHDKQHAREILASLREQFPANPLFAQEIAKLDAKR*
Ga0126372_1316071813300010360Tropical Forest SoilAIAYVRDKDKPKAREVLTSLRDEFPNNPLFSREIARLDSAK*
Ga0126377_1362014713300010362Tropical Forest SoilIAYVREKDTVKARELLAGLRDQYPKNPLFAREIARLQAH*
Ga0126379_1383013523300010366Tropical Forest SoilAVAYLRDKDTRHARELLAGLRDQFPANPLFAREIARLDHDRSGGE*
Ga0134125_1030253733300010371Terrestrial SoilILLAIAYVREKDKPRARELLTGLRQQFPNNSLFTREIARLDGVKVVNP*
Ga0134128_1040493813300010373Terrestrial SoilLAPFADILLAIAYVRDHDKQHARQLLAQLHDEFPENPLFPQEMARLDQAK*
Ga0105239_1126251223300010375Corn RhizospherePFARILLAIAYVREKDKPSALTMLASLRDEFPKNPLFAREIARLDTRN*
Ga0136449_10160874123300010379Peatlands SoilFARILLAIAYVRDKEKARARELLVALQNDFPQNPLFGREISRLDGQR*
Ga0136449_10200302813300010379Peatlands SoilARILLAIAYVREKDRPRAREILASLRDEFPRNPLFAREIARLDLER*
Ga0134124_1004197143300010397Terrestrial SoilRILLAIAYVREKDTMKARELLASLRDQYPKNPLFAREIARLQAQ*
Ga0134124_1065930823300010397Terrestrial SoilLLAIAYVREHDKPRARQLLASLRDEFPANPLFAQEIARLDESR*
Ga0137776_155244913300010937SedimentVREKNRGAAIELLSGLRQEFPGNTLFPREIARLQTAH*
Ga0137392_1034162133300011269Vadose Zone SoilVHDKDKPRARALLASLRDEFPNNPLFAREIARLDSGQ*
Ga0137389_1034153513300012096Vadose Zone SoilEKDKPHARELLASLRDEFPQNPLFAREIARLDSGP*
Ga0137362_1173125423300012205Vadose Zone SoilARILLAIAYVRDKNKPRALELLIALRTQFPGNTLFPREIARLQPAIGSPRAR*
Ga0137380_1116196923300012206Vadose Zone SoilLLAIAYVREHDYKHARELLASLRDQFPANPLFAQEIARLDAGN*
Ga0137379_1176139323300012209Vadose Zone SoilREKDKRRAMQLLTDLHSQFPANTLFPREIAHLQAAR*
Ga0137377_1183316123300012211Vadose Zone SoilFANILLSIAYVRDHDKQHARELLASLRDQFPGNPLFAEEIARLDASP*
Ga0150985_11415376923300012212Avena Fatua RhizosphereILLAIAYVRDKDNGKARELLARLRDEFPKNTLFPREIARLDAAH*
Ga0137372_1123242223300012350Vadose Zone SoilYVRDHENQRARELLGSLRDQFPANPLFAREIARLDSGR*
Ga0137366_1000398813300012354Vadose Zone SoilREHDNKRARELLATLRDQFPANPLFAQEIARLDSGR*
Ga0137366_1113205113300012354Vadose Zone SoilYVREKDKPRALLLLAGLRSEFPGNTLFPREIAHLQTAH*
Ga0137385_1107380823300012359Vadose Zone SoilLAIAYVREKDKPHARELLSSLRDEFPNNPLFAREIARLDYGH*
Ga0150984_10474307913300012469Avena Fatua RhizosphereRSLLAIAYVRDKDREHAREVLSSLRQDFPNNPLFGKEIARLSQE*
Ga0157314_102150913300012500Arabidopsis RhizosphereFARILLAIAFVREHKRPEARALLASLQQEFPNNPLFAREIARIDSSR*
Ga0137359_1083955513300012923Vadose Zone SoilIAYVREKDKPRAMQLLMGLRREFPANTLFPREIAHLQAAH*
Ga0137404_1087376513300012929Vadose Zone SoilIAYVRDKDKPKAREILTSLRDEFPNNPLFAREISRLDSGN*
Ga0164298_1043718223300012955SoilREKDKAHALEVLSGLEREFPSNTLFPREIARLQSAR*
Ga0164301_1159015923300012960SoilRILLAIAYVREKNKAHALELLSGLQHEFPGNTLFPREIARLQSAR*
Ga0164301_1161474523300012960SoilIAYVRDHDKKHARELLASLRDEFPANPLFSQEIARLDESH*
Ga0164302_1146476613300012961SoilFARILLAIAYVREKDKPKAREVLSLLRDEFPNNPLFAREILRLDTGN*
Ga0134110_1022775523300012975Grasslands SoilFANILLAVAYVREHDNQHARDLLASLRDQFPANPLFAQEIARLDSNK*
Ga0164304_1046037523300012986SoilPFARILLAIAYVRDKDNSKARELLANLRDEFPKNTLFPREIARLDAGH*
Ga0157372_1072658123300013307Corn RhizosphereFADILLAIAYVRDHDKQHARQLLAQLHDEFPANPLFPQEMARLDKGK*
Ga0134078_1026063513300014157Grasslands SoilKDKPRAREILASLRDEFPKNPLFAREIARLDSIH*
Ga0182024_1030656533300014501PermafrostAYVREKHKQRALQLLSSLQVQFPGNTLFPREIARLQSGR*
Ga0181516_1000596783300014655BogFARILLAIAYVRDKNKTEARQVLAGLRTEFPDNPPFDREISRLDQTR*
Ga0182006_101869113300015261RhizosphereIAYVRDKDREHAREVLSSLRQDFPNNPLFGKEIARLSQE*
Ga0182007_1012067213300015262RhizosphereILLAIAYVREKDKGRALQLLAGLQREFPGNTLFPREIARLQATH*
Ga0132257_10119043813300015373Arabidopsis RhizosphereILLAIAYVREKDKPKAREVLSLLRDEFPNNPLFAREILRLDTGS*
Ga0182037_1180933423300016404SoilYVRDHDKTQARALLASLRDEFPTNPLFAQEIARLDSR
Ga0182038_1103449413300016445SoilAYVREKEKPQAVELLSELQREFPGSPLFPRQIEHLQRSH
Ga0187818_1010775623300017823Freshwater SedimentAIAYVRDKDKPRAREILASLRDEFPGNPLFAREIARLDSQ
Ga0187824_1031815513300017927Freshwater SedimentLLAIAYVREKDKARALQLLAGLRDEYPGNSLFPREISRLEKTR
Ga0187801_1002435713300017933Freshwater SedimentRILLAIAYVREKDKARARELLVSLRNEFPQNPLFTQEIARLDTQISSNRP
Ga0187848_1004766133300017935PeatlandAPFARILLAIAYVRDKNKPRALELLASLRSEFPGNTLFPREIARLQTSISIPK
Ga0187853_1034561813300017940PeatlandPFARILLAIAYVRDKDKARALEVLQSLRTQFPANTLFPREIARLQDGH
Ga0187819_1018817323300017943Freshwater SedimentFARILLAIVYVREKDKARALQLLNGLRTEFPANTLFPREIARLQTAP
Ga0187817_1056669013300017955Freshwater SedimentILLAIAYVREKDKTRARDLLVLLRNDFPQNPLFAQEIGRLDAQR
Ga0187778_1025412723300017961Tropical PeatlandFARILLAIAYVREKDKAHARELLISLRQDFPQNPLFAREIGRLDGQP
Ga0187776_1002629333300017966Tropical PeatlandFARILLAIAYVRDKDRPRAREVLLSLKKDFPNNHLFPLELARLDQSATP
Ga0187783_1083549223300017970Tropical PeatlandAIAYVRENDKSRARELLVSLREDFPQNPLFAREIDRLDQQR
Ga0187783_1094910923300017970Tropical PeatlandLLAIACVREKDKTRAVELLTALRHDFPGNTLFPREIARLQAAH
Ga0187777_1087659523300017974Tropical PeatlandFARILLAIAYVRDRDNTRAREILAALRDEFPKNPLFAHEIARLDGVQINDSMH
Ga0187782_1020780923300017975Tropical PeatlandRDNNKPRAREMLVSLEQEFPQNPLFAREIGRLDAER
Ga0187767_1009284513300017999Tropical PeatlandARILLALAYLREKDTPRARELLVSLRNDFPENPLFAREIGRLDAQR
Ga0187873_105551213300018013PeatlandFARILLAIAYVRDKDVPRARELLLALQREFPDNTLFGRELTRLDHNGNR
Ga0187863_1040087723300018034PeatlandYLKPFARILLAIAYVRDKDKTRALELLVALRTQFPGNTLFPREIARLTPSATSAH
Ga0187766_1084768213300018058Tropical PeatlandRILLAIAYVREKDKSRALQQLTELRTHYPANTLVSREIARLQSSE
Ga0187784_1078873423300018062Tropical PeatlandARILLAIAYVRDKEKARALEVLSALRADFPGNTLFPREIMRLQSAH
Ga0184639_1025745723300018082Groundwater SedimentDKDTGRARALLAGLRDEFPKNPLFAREIARLDAGQ
Ga0187769_1060118223300018086Tropical PeatlandPFARVLLAIAYVRDKDKARALDLLTSLRTEFPGNPLFPREISRLQGGR
Ga0187769_1066251123300018086Tropical PeatlandAYVREKDKTRALELLTGLRQEFPANTLFSREIVRLEGAH
Ga0187771_1035833713300018088Tropical PeatlandYVREKDKVRAVELLTTLRRDFPGNTLFPREIARLQAAH
Ga0187770_1081940313300018090Tropical PeatlandIAYVRDKDRARALSMLTGLRQEFPANTLFPREIARLEIGSR
Ga0182025_112848533300019786PermafrostARVLLAIVYVREKNNSRALQLLAGLRRQFPANTLFPREIAHLQSER
Ga0193747_113217423300019885SoilYVREKDKPRARELLASLRDDFPKNPLFAKEIARLDSGQ
Ga0193751_108406013300019888SoilVRDKDKRRALQMLDGLRTEFPGNTLFPREIARLERAH
Ga0210407_1001429713300020579SoilVREKDKAQALEMLTGLRAEFPGNSLFAREIARLQSGG
Ga0210399_1047009813300020581SoilEKDNSRALQLLTGLRREFPANTLFSREIAHLQSAP
Ga0210399_1152464413300020581SoilAPFARILLAIAYVREKDRPRALELLAGLQREFPGNTLFPREIAHLRAVH
Ga0210401_1071375313300020583SoilARILLAIAYVRDKDNSRARELLASLRDEFPKNTLFTNEIARLDAGH
Ga0210406_1042892913300021168SoilAIAYVREKDKIRALQVLHDLHIEFPGNTLFPHEIARLQSPH
Ga0210405_1093991113300021171SoilAYVREKDKPRARELLASLRDEFPRNPLFAREIARLDAGQ
Ga0210388_1042651413300021181SoilILLAIAYVREKDKAHALQLLTDLGREFPANTLFPREIAHLQALR
Ga0213874_1037727923300021377Plant RootsLLAIAYVRDHDKQHARELLLSLHDQFPSNPLFVREMARLDASR
Ga0210393_1024287233300021401SoilLAIAYVRERDKPRAVQLLTSLRDQYPANPLFAREISRLESSR
Ga0210385_1013694433300021402SoilLAIAYVREKNKSAAIQLLAGLHSEFPSNTLFPREIARLEAAH
Ga0210385_1113085413300021402SoilFARILLAIAYVRDKDKGRALQILTALRTQFPANTLFPQEIARLQNGH
Ga0210397_1006999033300021403SoilARILLSIAYVREKNKAQALQLLTGLQSEFPANTLFPREIAHLQSTH
Ga0210389_1068511913300021404SoilRILLAIAYVREKDQARARQLLVSLRDQFPQNPLFGEEIARLDTRPGN
Ga0210383_1008654133300021407SoilIAYVRDKDKPHALELLSSLRTRFPGNTLFPREIDRLQSAH
Ga0210394_1016812613300021420SoilLAIAYVRDKDKSRARQLLVSLRDQFPQNPLFEQEIARLDTRPGN
Ga0210390_1059885223300021474SoilAPFARILLAIAYVREKNKSAAIQLLAGLHREFPSNTLFPREIARLEAAH
Ga0210402_1129612523300021478SoilVARILLAIAYVRDKDTARARGVLASLRDEFPKNPLFAQEIARLDATH
Ga0210402_1135619713300021478SoilARILLAIAYVREKDKPRARELLIGLRDQFPQNALFGEEIARLDGRP
Ga0210410_1095216123300021479SoilAPLARILLSIAYVREKDKPRALELLTNLSRDFPENTLFSRQIAHLQSAR
Ga0210409_1059982413300021559SoilRILLAIAYVREKDKPRALRLLAGLQHDFPGNALFPREIARLQSAH
Ga0126371_1235237523300021560Tropical Forest SoilAIAYVRDKDNARSRQLLASLRDDFPGNPLFQRKLARSDSGH
Ga0242655_1000182233300022532SoilFARILLAIAYVREKDNSKALQLLAGLRRDFPENELFSREIAHLQAAH
Ga0212123_1024606223300022557Iron-Sulfur Acid SpringFARILLAIAYVREKDKPRARQLLISLRDQFPKNPLFEQEIARLDTWPAPDN
Ga0212123_1025473523300022557Iron-Sulfur Acid SpringFARILLSIAYVREKDKSRALQLLIGLRREFPANTLFSREIAHLQSSH
Ga0212128_1000661513300022563Thermal SpringsLLAVAHLREKDIAQARALLTGLRDEFPANPLFARELARLEKDPSCKNC
Ga0224562_101363123300022733SoilIAYVRDKDKPRAIQLLMGLRAQFPANPLFERELARLQPVP
Ga0233359_104648513300024049SoilLSIAYVRDKNKIRALELLTALRAQFPENTLFPREIARLQPNFTK
Ga0247668_102881323300024331SoilAIAYVREKDKARAIEILSSLETEFPENSLFPREISRLRASR
Ga0207684_1120790723300025910Corn, Switchgrass And Miscanthus RhizosphereVRDHDRKHARELLASLRDEFPANPLFAQEIARLDAVH
Ga0207654_1072857123300025911Corn RhizosphereILLAIAYVRDHDKKHARELLASLRDEFPANPLFAQEIARLDEVH
Ga0207654_1140798123300025911Corn RhizosphereIAYVRDHDKKRARELLAQLHDEFPANPLFPQEIARLDAGR
Ga0207671_1035115613300025914Corn RhizosphereLLAIAYGRDHDKQHARQLLAQLHDEFPANPLFPQEMARLDKGR
Ga0207663_1000247713300025916Corn, Switchgrass And Miscanthus RhizosphereVRDNDTAKARSVLASLRDEFPKNPLFAQEIAHLDSAK
Ga0207663_1011275113300025916Corn, Switchgrass And Miscanthus RhizosphereREKKKAHAIELLADLQREFPGNSLFPRQIAHLRSSQK
Ga0207663_1104657623300025916Corn, Switchgrass And Miscanthus RhizosphereAPFANILLAIAYVRDHDKPHARELLASLRDQFPANPLFAQEIARLDAAR
Ga0207660_1011389613300025917Corn RhizosphereLAIAYVRDHDKQRARQLLSQLHQEFPANPLFSQEMARLDAGR
Ga0207700_1016268333300025928Corn, Switchgrass And Miscanthus RhizosphereLLAIAYVREHDKQHARQLLSQLHDEFPANPLFPQEMARLDKGK
Ga0207664_1000647373300025929Agricultural SoilARILLSIAYVREKDKPRAMQLLTSLHAEFPDNTLFPREIAHLQAPR
Ga0207664_1046496713300025929Agricultural SoilDKDKTRAIELLAGLQKEFPGNSLFGREIAHLQAAR
Ga0207665_1045399813300025939Corn, Switchgrass And Miscanthus RhizosphereLAIAYVRDHDKKHARELLASLRDEFPANPLFSQEIARLDESH
Ga0207667_1163883823300025949Corn RhizosphereEHKRPEARALLASLQQEFPNNPLFAREIARLDSSR
Ga0207667_1205131223300025949Corn RhizosphereFARILLAIAYVREKDKPSALTMLASLRDEFPKNPLFAREIARLDTRN
Ga0207677_1104651413300026023Miscanthus RhizosphereRILLAIAYVREKDKGRALQLLAGLQREFPGNTLFPREIARLQATQ
Ga0207639_1229850123300026041Corn RhizospherePFARILLAIAYVREKDKGRALQLLAGLQREFPGNTLFPREIARLQATH
Ga0207641_1037264023300026088Switchgrass RhizosphereYVRDKDNNKARELLANLRDEFPKNTLFPREIARLDAGH
Ga0207698_1166799723300026142Corn RhizosphereLLAIAYVRDHDKQRARQLLSQLHQEFPANPLFSQEMARLDAGR
Ga0209863_1001737023300026281Prmafrost SoilREHDKTHARQLLASLRDQYPGNPLFAQEIARLDSGH
Ga0209863_1015846513300026281Prmafrost SoilVRDKDKSRARELLTGLRDEFPSNPLFVREIARLDSGH
Ga0209238_118428313300026301Grasslands SoilRDHDKQHARELLASLEVQFPSNPLFAEEIAKLNSSH
Ga0209240_124429213300026304Grasslands SoilVREKDRTRALQLLTGLRTEFPGNPLYGREIARLQTGH
Ga0209687_130688313300026322SoilLAIAYVRDRDRGRAREVLIALRDEFPQSPLFAREIARLDATH
Ga0209803_110283813300026332SoilAIAYVREKDKPHARELLSSLRDEFPNNPLFAREIARLDYGH
Ga0209803_132727213300026332SoilRILLAIAYVREKDKRHARELLSSLREEFPNNPLFAREIARLDYGH
Ga0209161_1056273723300026548SoilRILLAIAYVREKDKPRAREILASLRDEFPKNPLFAREIARLDSIH
Ga0209648_1067359723300026551Grasslands SoilDHDKTHARELLASLRDQFPANPLFAQEIARLDAAR
Ga0209577_1044037323300026552SoilVREKDKPRARELLASLRDDFPKNPLFAKEIARLDSGQ
Ga0207727_11798923300026854Tropical Forest SoilAYVREKDKARAVRLLSGLQSEFPRNTLFQRQIAHLQASH
Ga0209332_103922413300027439Forest SoilRVLLAIAYVRDKNKPRAIELLTSLQAQFSGNTLFPREITRLQAAH
Ga0209525_100586613300027575Forest SoilAVAYVREKDNSRALQLLTGLRSEFPANTLFPREIAHLRDAPQR
Ga0209003_104948013300027576Forest SoilILLAIAYVREKDKPRALEMLASLHDEFPNNSLFTREIARLEASR
Ga0209528_105750123300027610Forest SoilRILLAIAYVRDKDNNRALQMLAGLRTEFPGNTLFPREIARLEQAR
Ga0209528_107899113300027610Forest SoilRILLAIAYVRDKDNNRARELLASLRDEFPKNTLFTNEIARLDAGH
Ga0209117_115122413300027645Forest SoilYVRDKDKPRALALLTSLRAQFPGNTLFPREIARLQTAH
Ga0209420_111862313300027648Forest SoilARILLAIAYVRDKDNPRALELLMALRTQFPGNTLFPREIARLTPSVTSAH
Ga0209420_114166623300027648Forest SoilILLAIAYVREKNKVRALELLSALRSQFPGNTVFPREIARLQAGH
Ga0209908_1024269523300027745Thawing PermafrostLKPFARILLAIAYVRDKDKTRALELLTALSIQFPGNTLFPREIARLTPSVTSAP
Ga0209139_1022035423300027795Bog Forest SoilILLAIAYVRDKDNERALNVLKSLRTQFPANTLFPREIARLQNGH
Ga0209773_1040414513300027829Bog Forest SoilAIAYVREKDKSRARELLVSLRNDFPQNPLFAREIGRLDAQR
Ga0209166_1000665213300027857Surface SoilILLAIAYTREKNKPRAIELLAGLQKEFPGNTLFARQIAHLQAGR
Ga0209701_1018536723300027862Vadose Zone SoilEKDRTRALQLLTGLRTEFPGNPLYGREIARLQTGH
Ga0209701_1047463923300027862Vadose Zone SoilVRDKDKPRARALLASLRDEFPNNPLFAREIARLDSGQ
Ga0209167_1081566523300027867Surface SoilGHYLKPFARILLAIAYVRDKDKERALEVLKSLRTQFPANTLFPREIARLQTAH
Ga0209488_1017813233300027903Vadose Zone SoilAPFARVLLAIAYVRDKDKPRALELLTSLRAQFPNNTLFPREIIRLQASQ
Ga0209488_1047960023300027903Vadose Zone SoilREKDKPRARELLAALRDDFPKNPLFAREIARLDSGQ
Ga0209698_1001300713300027911WatershedsFARILLAIAYVREKDTARAREMLIGLRREFPENALFDKELARLDKTARR
Ga0209526_1052882133300028047Forest SoilLLAIAYVRDKDNVRARELLASLRDEFPKNTLFTNEIARLDAGH
Ga0302231_1035180223300028775PalsaILLAIAYVRDKDNTRALVLLTSLRTQFPGNTLFPREIARLQPSVTSEH
Ga0307312_1076103313300028828SoilGPFARILLAIAYVRDKDNVRARELLASLRDEFPKNTLFTNEIARLDAGH
Ga0311339_1021222033300029999PalsaILLAIAYVRDKNNPRALELLIGLRTQFPGNTLFPREIARLTPSVTSAH
Ga0302281_1026580523300030044FenKPFARILLAIAYVRDKNKTRALELLVALRSQFPGNTLFPREIARLQPSVTK
Ga0302179_1053658413300030058PalsaPFARILLAIAYVRDKDKPRAIQLLIGLRAQFPANPLFARELVRLQPAP
Ga0302192_1039427713300030507BogILLAIAYVRDKDKTRALELLTSLRTQFPGNTLFPREIARLQPSVMAAH
Ga0302316_1029807523300030646PalsaPFARILLAIAYVRDKDNTRALVLLTSLRTQFPGNTLFPREIARLQPSVTSEH
Ga0310039_1008652213300030706Peatlands SoilARILLAIAYVRDKDKSRALQLLTSLRSQFPGNTLFPREISRLQSAH
Ga0310039_1040331123300030706Peatlands SoilAYVREKDNPRALLLLEGLQIEFPSNALFSREITHLHAAR
Ga0170834_10653821123300031057Forest SoilSIAYVREKDKPRAMQLLTSLHAEFPANAIFPREIAHLQAAH
Ga0170834_10661098913300031057Forest SoilPFARVLLAIAYVRDKNKPRALELLASLRTQFPDNTLFPREITRLQAAR
Ga0310915_1044843913300031573SoilAIAYVREKDNPRAVELLSGLQREFPGNSLFPREIAHLRTSH
Ga0310686_10254751313300031708SoilIAYVREKDNSRALQLLTGLRSEFPANTLFPREIAHLRDAPQR
Ga0310686_11118652213300031708SoilILLSIAYVRDKDKAGALQLLTALRTQFPANTLFPREIARLENGR
Ga0310686_11923338123300031708SoilFARILLAIAYVRDKDKFRALQLLTSLRAQFPGNTLFPREISRLQSAH
Ga0307474_1008733813300031718Hardwood Forest SoilVREKDKSRALQLLTGLQQEFPGNTLFPREIAHLESSH
Ga0307477_1004762333300031753Hardwood Forest SoilEKDKPRALQLLTGLRSEFPSNTVFPREIARLQTAP
Ga0307475_1045698513300031754Hardwood Forest SoilARVLLAIAYVRGKDKQHALELLASLRTQFPANPLFPREISRLQASIRSSTAP
Ga0307475_1066017323300031754Hardwood Forest SoilRILLAIACVREKDKPLARELLASLRDQFPANPLFPLEIARLDSH
Ga0214473_1103993923300031949SoilDNNRAQAREILLGLRDDFPSNPLFAREIARLDGDIN
Ga0306926_1037388213300031954SoilREHDKQHARQLLASLRDQFPANPLFAREIARLDSTR
Ga0307479_1003202263300031962Hardwood Forest SoilVREKDKSRALQLLASLHDEFPHNPLFPREMARLGSTAGF
Ga0307479_1081771713300031962Hardwood Forest SoilAYVREKDKPRALQLLAGLRAEFPGNPLFSRQMARLENRR
Ga0307479_1128715223300031962Hardwood Forest SoilLAIAYVREKDKPQARELLASLRGQFPANPLFPLEIARLDSR
Ga0307479_1156526423300031962Hardwood Forest SoilPRTPSARIQLAIAYVRDKNKPRALELLSSLRTDFPGNTLFAREIIRLQSVH
Ga0307479_1180748723300031962Hardwood Forest SoilSIAYVREKDKPQARELLASLRDQFPANPLFPLEIARLDSH
Ga0306922_1111596723300032001SoilLLAIAYVREKDKPQAVELLSELQREFPGNPLFPRQIEHLQRSH
Ga0307471_10065946713300032180Hardwood Forest SoilARMMLAIAYVREKDKPKARSLLASLRDEFPENPLFALEIARLDAAH
Ga0307471_10301358613300032180Hardwood Forest SoilPFARILLAIVYVREKDKPRALQLLTGLRSEFPANTLFPREIARLQTGP
Ga0307471_10350486523300032180Hardwood Forest SoilPFARMLLAIAYVREKDKPRARELLASLRDEFPRNPLFAREIERLDAGQ
Ga0307472_10066441823300032205Hardwood Forest SoilYMAPFARILLAIAYVREKDRARALELLTGLQHEFPGNTLFPREIAHLRAVH
Ga0307472_10085436633300032205Hardwood Forest SoilLAIAYVREKDKPKARSLLASLRDEFPENPLFALEIARLDAGH
Ga0335085_1152798413300032770SoilARILLSIAYVREKDDLRALQLLTGLQREFPGNALFSREIARLQTTR
Ga0335079_1128272213300032783SoilYVRDHDKQRAVELLASLRNEFPANPLFAQEIARLDSSQ
Ga0335078_1180842613300032805SoilREKDDLRALQLLTGLQREFPGNALFSREIARLQTTR
Ga0335080_1173086513300032828SoilLREKDKGRARDLLVSLRNDFPENPLFAREIGRLDSQR
Ga0335075_1150833213300032896SoilARILLAIAYVRDRNKQRALDVLSALRSEFPRNTLFPKEIARLESGH
Ga0335071_1179306823300032897SoilILLAIAYVREKDKSHALQLLTGLQRDFPSNALFPREIARLEASH
Ga0335072_1105221823300032898SoilIAYVREKDKPRAIEILTSLRSDFPANPLFGREIARLQSGQ
Ga0335076_1008136733300032955SoilYVREKDKGKALELLAGLRRDFPGNTLFPREIAHLQASH
Ga0310810_1017549233300033412SoilARILLSIAYVRDKDKTRAIELLAGLQKEFPGNSLFGREIAHLRAAR
Ga0214471_1142839713300033417SoilAPYARILLAIASLRDDDRTQARSLLVGLRDDFPSNLLFAREIARIDGATN
Ga0334854_156809_428_5533300033829SoilAIAYVREKDKPRARETLTGLRAEFPANLLFAREIGRLDAKP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.