NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233359_1033122

Scaffold Ga0233359_1033122


Overview

Basic Information
Taxon OID3300024049 Open in IMG/M
Scaffold IDGa0233359_1033122 Open in IMG/M
Source Dataset NameSoil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-P30
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)597
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)40.5253Long. (o)-123.5031Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013050Metagenome / Metatranscriptome275Y

Sequences

Protein IDFamilyRBSSequence
Ga0233359_10331221F013050AGGMSKGKQPRTRVNKVPKLLLSEIKVVVILTDQEMGLEAAIF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.