Scaffold Ga0257047_10049

Overview

Basic Information

• Taxon OID: 3300023716
• Scaffold ID: Ga0257047_10049
• Source Dataset Name: Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_34A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Irvine
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 164380
• Total Scaffold Genes: 163
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 145 (88.96%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome

Source Dataset Sampling Location

• Location Name: USA: Northridge, California
• Coordinates
  • Lat. (^o): 34.2381
  • Long. (^o): -118.5301

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068811	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0257047_10049116	F068811	AGGA	MDQDGSEHNICPNREGLCPGKEPHGASGWKKIFQHGKEPLRNKDSISQYCNKKAAVSLILNENVSETLCIFSIDKTNCCRI