Basic Information | |
---|---|
IMG/M Taxon OID | 3300023716 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133482 | Gp0296399 | Ga0257047 |
Sample Name | Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_34A |
Sequencing Status | Permanent Draft |
Sequencing Center | University of California, Irvine |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 84983226 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Child Gut Microbiome |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Northridge, California | |||||||
Coordinates | Lat. (o) | 34.2381 | Long. (o) | -118.5301 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068811 | Metagenome | 124 | N |
F076189 | Metagenome | 118 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0257047_10049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 164380 | Open in IMG/M |
Ga0257047_10146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 81713 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0257047_10049 | Ga0257047_10049116 | F068811 | MDQDGSEHNICPNREGLCPGKEPHGASGWKKIFQHGKEPLRNKDSISQYCNKKAAVSLILNENVSETLCIFSIDKTNCCRI |
Ga0257047_10146 | Ga0257047_1014620 | F076189 | MPGRLCYLPGIAFFLSPFIKPLLYVEKLQIGTVLPVVSDLYREFAELSAHFDLYAIQSAQKQLRMLCNFHENTFGLLIFYTNYAIL |
⦗Top⦘ |