Scaffold Ga0256727_1103575

Overview

Basic Information

• Taxon OID: 3300023548
• Scaffold ID: Ga0256727_1103575
• Source Dataset Name: Hydrothermal Fe-rich mat microbial community from Loihi Seamount, Hawaii, USA - 677-SSYellow
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 821
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location

• Location Name: USA: Loihi Seamount, Hawaii
• Coordinates
  • Lat. (^o): 18.905558
  • Long. (^o): -155.256977
  • Depth (m): 1271.23

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094884	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256727_11035753	F094884	GAGG	MTKNKLIGSTYVNIIKDEKGEIKFAYGYEVDDNEVSLNDLAMLNSFLDKIKDMAKQDFQERLDKNDKEFSIESDGTQ