Scaffold Ga0256751_1027979

Overview

Basic Information

• Taxon OID: 3300023442
• Scaffold ID: Ga0256751_1027979
• Source Dataset Name: Hydrothermal Fe-rich mat microbial community from Rainbow Site, Mid-Atlantic Ridge, Atlantic Ocean - 664-SC8
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2046
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location

• Location Name: International: Rainbow Site, Mid-Atlantic Ridge
• Coordinates
  • Lat. (^o): 36.229322
  • Long. (^o): -33.902767
  • Depth (m): 2294.86

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093968	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256751_10279791	F093968	AGGAG	MTHGDGLPRFSALSVRCGDAGHREACATPSESLGK