Scaffold Ga0256752_1086748

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256752_1086748

Scaffold Ga0256752_1086748

Overview

Basic Information
Taxon OID	3300023439 Open in IMG/M
Scaffold ID	Ga0256752_1086748 Open in IMG/M
Source Dataset Name	Hydrothermal Fe-rich mat microbial community from TAG Site, Mid-Atlantic Ridge, Atlantic Ocean - 665-MMA12
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Delaware
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	723
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location
Location Name	International: TAG Site, Mid-Atlantic Ridge
Coordinates	Lat. (^o)	26.137196	Long. (^o)	-44.826442	Alt. (m)		Depth (m)	3626.4
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038413	Metagenome	166	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256752_10867481	F038413	N/A	MCAFYRSREGALTAADSMTSLGSLYGQSTTASVQIPKQATSIVGIIATVATDSATNGATTFAM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.