Scaffold Ga0256748_1154492

Overview

Basic Information

• Taxon OID: 3300023313
• Scaffold ID: Ga0256748_1154492
• Source Dataset Name: Hydrothermal Fe-rich mat microbial community from Urashima Vent Field, Mariana Arc, Pacific Ocean - 801-BM1-B4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 665
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location

• Location Name: International: Urashima Vent Field, Mariana Arc
• Coordinates
  • Lat. (^o): 12.92235
  • Long. (^o): 143.64925
  • Depth (m): 2929.9

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083241	Metagenome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0256748_11544922	F083241	N/A	MTPWAMLQYVDIVEPVGDAFADWEVFYAGWENQAAKLMPVEYQEEYKMRYWMAGAPTPGFFMQISTPTFSPDATSVPAPVSFELFTTGRRSIDVRTA