Scaffold Ga0256722_133012

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256722_133012

Scaffold Ga0256722_133012

Overview

Basic Information
Taxon OID	3300023310 Open in IMG/M
Scaffold ID	Ga0256722_133012 Open in IMG/M
Source Dataset Name	Hydrothermal Fe-rich mat microbial community from Loihi Seamount, Hawaii, USA - 674-BM1-C3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Delaware
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	900
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location
Location Name	USA: Loihi Seamount, Hawaii
Coordinates	Lat. (^o)	18.901418	Long. (^o)	-155.258191	Alt. (m)		Depth (m)	1179.43
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008189	Metagenome / Metatranscriptome	337	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256722_1330122	F008189	AGGAGG	MDYKEELKRLQEGSNYWKPKVGQYKLKALSELEEADPFVKQREGQEDEVHPQMKIKVTIDGEEKLWTFGKGKTPASTYGQLVELASKHANQLTNVEFSVVVKSDGTKNDYTIVN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.