Scaffold Ga0256722_109330

Overview

Basic Information

• Taxon OID: 3300023310
• Scaffold ID: Ga0256722_109330
• Source Dataset Name: Hydrothermal Fe-rich mat microbial community from Loihi Seamount, Hawaii, USA - 674-BM1-C3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Delaware
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2158
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location

• Location Name: USA: Loihi Seamount, Hawaii
• Coordinates
  • Lat. (^o): 18.901418
  • Long. (^o): -155.258191
  • Depth (m): 1179.43

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088125	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256722_1093305	F088125	AGGAGG	MYLLDAGRVALFSIFLVATLRFFYLAWQTHNAHSDDVVVQQHFMEHAIAAAFAFIGSLLGVLYSIVHLFSVEQGVLSETPFTVSMLFMLISGVAFMIHMIKEQTPHHPFYIRENNEDD