NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222635_1009521

Scaffold Ga0222635_1009521


Overview

Basic Information
Taxon OID3300023234 Open in IMG/M
Scaffold IDGa0222635_1009521 Open in IMG/M
Source Dataset NameSaline water microbial communities from Ace Lake, Antarctica - #139
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1801
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Ace Lake
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)15
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007738Metagenome345Y

Sequences

Protein IDFamilyRBSSequence
Ga0222635_10095211F007738AGGAMSGADITADVQAAYVEAGIAAGNGTGAPIVTINRTGTPTGDEWNPTSGASVTHTFTAKPSGKAYTQRTGLALGAKEQVYSLVNIGVTITPSTTDVLTIDGVEWSVLEVIPMDSAGYVISWLVKVY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.