NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255842_1260316

Scaffold Ga0255842_1260316


Overview

Basic Information
Taxon OID3300023211 Open in IMG/M
Scaffold IDGa0255842_1260316 Open in IMG/M
Source Dataset NameActivated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterArgonne National Laboratory
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)414037
Total Scaffold Genes402 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)54 (13.43%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Ppcp Degradation By Aerobic Enrichment Cultures (Carbon Source)

Source Dataset Sampling Location
Location NameFort Collins, Colorado, USA
CoordinatesLat. (o)40.585258Long. (o)-105.084419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034611Metagenome / Metatranscriptome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0255842_1260316356F034611N/AMEHGKTILSLTTDLLANGGFSHLKDDQVSMLHHLILRLKEPLSIIQQNLLLTFWNNADATNIPPALLYRCNTILQQHGRSPIQELYAEVEMD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.