Scaffold Ga0255812_10011594

Overview

Basic Information

• Taxon OID: 3300023203
• Scaffold ID: Ga0255812_10011594
• Source Dataset Name: Combined Assembly of Gp0238866, Gp0238878
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3956
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: University of Toronto, Toronto, Ontario, Canada
• Coordinates
  • Lat. (^o): 43.5479
  • Long. (^o): -79.6609

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076867	Metagenome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0255812_100115944	F076867	GGA	MDEKNRNLVEIAKKKRYIALVEKLGRGSLSSKELKELEEFEKSEQRPAGVIDGTVDLPTLCVYLEKSPRMIRRYVQQGMPVFRDAVGEIARFKVGDVFKWFYKKQGSEEDNGKDYWDKEYRKNRAKLSEIELKQKEGEVIPFEDHVSIVKNQIRGIKAGFLRLPKQIAP