Basic Information | |
---|---|
Taxon OID | 3300023201 Open in IMG/M |
Scaffold ID | Ga0256614_1216776 Open in IMG/M |
Source Dataset Name | Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? PN |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Argonne National Laboratory |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 713 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin397 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Ppcp Degradation By Aerobic Enrichment Cultures (Carbon Source) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fort Collins, Colorado, USA | |||||||
Coordinates | Lat. (o) | 40.585258 | Long. (o) | -105.084419 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002371 | Metagenome / Metatranscriptome | 566 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256614_12167763 | F002371 | N/A | MKLQPKKKKETRGGTRQGSGAKPKYNEGTKTVAFRCPLSKVDELKLVVKSKLFEWLVK |
⦗Top⦘ |