NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256614_1079771

Scaffold Ga0256614_1079771


Overview

Basic Information
Taxon OID3300023201 Open in IMG/M
Scaffold IDGa0256614_1079771 Open in IMG/M
Source Dataset NameActivated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? PN
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterArgonne National Laboratory
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)799
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Ppcp Degradation By Aerobic Enrichment Cultures (Carbon Source)

Source Dataset Sampling Location
Location NameFort Collins, Colorado, USA
CoordinatesLat. (o)40.585258Long. (o)-105.084419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077430Metagenome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0256614_10797711F077430AGGAGMYYIVEITAQGIETFLEGFEDVGEAWDTVSRLRCEARRQRRNVRYEVR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.