NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214919_10031317

Scaffold Ga0214919_10031317


Overview

Basic Information
Taxon OID3300023184 Open in IMG/M
Scaffold IDGa0214919_10031317 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5538
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (12.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043782Metagenome / Metatranscriptome155N
F071985Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0214919_100313174F071985N/AMKELEDFKFSSRIEVSDELANKLALIPIQSSTPIFHFYYAAAAIVLLILINVFAVLYSNQTKKINIENTEYFEEWT
Ga0214919_100313175F043782N/AMKRYKVIIWFLVIINIGLISFMFLQHRTHQRPRIVKILTIDDTRAIEINRMEIIHFKEKKKLIDKSKKLRAKLLFSFENEIPESQADSILHLISDNQYELDKMTYLFFKDIKSKCSVKEREKLNNFFTRVLEEGPRNKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.