NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214919_10001031

Scaffold Ga0214919_10001031


Overview

Basic Information
Taxon OID3300023184 Open in IMG/M
Scaffold IDGa0214919_10001031 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)46982
Total Scaffold Genes78 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)50 (64.10%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045555Metagenome / Metatranscriptome152Y
F064667Metagenome / Metatranscriptome128N
F102821Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0214919_1000103120F045555AGGAMTSIFIVRAEYCGAPESHIYGVYPTVELALARIAVLEGEDFGYEIAWYDEVTVGPDGADCCLANR
Ga0214919_100010316F064667AGGAGMFIGLMGVDSDGKTMYTPSGEKIFFTLPWGLARQAQRIQHWIARKTWR
Ga0214919_100010318F102821N/AMIVRLANKIGQLHGRFFIWLGHKAESNPWWAVALTVWALYEIGEHIAGPVMAVLYATGHMTFN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.