| Basic Information | |
|---|---|
| Family ID | F064667 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIARKTW |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 92.19 % |
| % of genes near scaffold ends (potentially truncated) | 14.06 % |
| % of genes from short scaffolds (< 2000 bps) | 57.03 % |
| Associated GOLD sequencing projects | 52 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.250 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (56.250 % of family members) |
| Environment Ontology (ENVO) | Unclassified (88.281 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (94.531 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.04% β-sheet: 25.53% Coil/Unstructured: 40.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF01192 | RNA_pol_Rpb6 | 9.38 |
| PF04055 | Radical_SAM | 5.47 |
| PF05433 | Rick_17kDa_Anti | 5.47 |
| PF01145 | Band_7 | 3.91 |
| PF13609 | Porin_4 | 3.12 |
| PF01970 | TctA | 2.34 |
| PF01503 | PRA-PH | 1.56 |
| PF05118 | Asp_Arg_Hydrox | 1.56 |
| PF07460 | NUMOD3 | 1.56 |
| PF00550 | PP-binding | 1.56 |
| PF01844 | HNH | 0.78 |
| PF05292 | MCD | 0.78 |
| PF01391 | Collagen | 0.78 |
| PF13240 | zinc_ribbon_2 | 0.78 |
| PF13505 | OMP_b-brl | 0.78 |
| PF00462 | Glutaredoxin | 0.78 |
| PF12849 | PBP_like_2 | 0.78 |
| PF13394 | Fer4_14 | 0.78 |
| PF09825 | BPL_N | 0.78 |
| PF00908 | dTDP_sugar_isom | 0.78 |
| PF10902 | WYL_2 | 0.78 |
| PF00535 | Glycos_transf_2 | 0.78 |
| PF00301 | Rubredoxin | 0.78 |
| PF00034 | Cytochrom_C | 0.78 |
| PF01242 | PTPS | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 9.38 |
| COG1784 | TctA family transporter | General function prediction only [R] | 2.34 |
| COG3333 | TctA family transporter | General function prediction only [R] | 2.34 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 1.56 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.78 |
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.25 % |
| All Organisms | root | All Organisms | 43.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003277|JGI25908J49247_10096098 | Not Available | 717 | Open in IMG/M |
| 3300003490|JGI25926J51410_1075613 | Not Available | 554 | Open in IMG/M |
| 3300004693|Ga0065167_1039081 | Not Available | 768 | Open in IMG/M |
| 3300004772|Ga0007791_10140370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
| 3300004774|Ga0007794_10007433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3309 | Open in IMG/M |
| 3300004774|Ga0007794_10224214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300004790|Ga0007758_11232884 | Not Available | 709 | Open in IMG/M |
| 3300004792|Ga0007761_10048547 | Not Available | 1488 | Open in IMG/M |
| 3300004804|Ga0007796_10010177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3564 | Open in IMG/M |
| 3300004804|Ga0007796_10191209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300004805|Ga0007792_10282484 | Not Available | 509 | Open in IMG/M |
| 3300005527|Ga0068876_10569742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
| 3300005662|Ga0078894_11643894 | Not Available | 529 | Open in IMG/M |
| 3300006639|Ga0079301_1083275 | Not Available | 995 | Open in IMG/M |
| 3300007597|Ga0102919_1143362 | Not Available | 751 | Open in IMG/M |
| 3300009068|Ga0114973_10011248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5780 | Open in IMG/M |
| 3300009068|Ga0114973_10425570 | Not Available | 693 | Open in IMG/M |
| 3300009151|Ga0114962_10013567 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5922 | Open in IMG/M |
| 3300009151|Ga0114962_10027449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3942 | Open in IMG/M |
| 3300009151|Ga0114962_10035849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3366 | Open in IMG/M |
| 3300009151|Ga0114962_10039886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3159 | Open in IMG/M |
| 3300009151|Ga0114962_10057998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2523 | Open in IMG/M |
| 3300009151|Ga0114962_10069528 | Not Available | 2259 | Open in IMG/M |
| 3300009151|Ga0114962_10088594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1948 | Open in IMG/M |
| 3300009151|Ga0114962_10130907 | All Organisms → Viruses → Predicted Viral | 1527 | Open in IMG/M |
| 3300009151|Ga0114962_10381740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300009151|Ga0114962_10491718 | Not Available | 650 | Open in IMG/M |
| 3300009151|Ga0114962_10682372 | Not Available | 527 | Open in IMG/M |
| 3300009152|Ga0114980_10162828 | Not Available | 1320 | Open in IMG/M |
| 3300009158|Ga0114977_10002836 | Not Available | 11153 | Open in IMG/M |
| 3300009158|Ga0114977_10036954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3051 | Open in IMG/M |
| 3300009158|Ga0114977_10175493 | Not Available | 1266 | Open in IMG/M |
| 3300009159|Ga0114978_10062378 | Not Available | 2531 | Open in IMG/M |
| 3300009159|Ga0114978_10329105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
| 3300009161|Ga0114966_10000342 | Not Available | 45169 | Open in IMG/M |
| 3300009161|Ga0114966_10638121 | Not Available | 590 | Open in IMG/M |
| 3300009163|Ga0114970_10015199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5298 | Open in IMG/M |
| 3300009163|Ga0114970_10037696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3182 | Open in IMG/M |
| 3300009163|Ga0114970_10041871 | Not Available | 2994 | Open in IMG/M |
| 3300009163|Ga0114970_10329562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
| 3300009164|Ga0114975_10046062 | Not Available | 2582 | Open in IMG/M |
| 3300009164|Ga0114975_10067162 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2094 | Open in IMG/M |
| 3300009164|Ga0114975_10136836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1406 | Open in IMG/M |
| 3300009164|Ga0114975_10524170 | Not Available | 637 | Open in IMG/M |
| 3300009164|Ga0114975_10586002 | Not Available | 596 | Open in IMG/M |
| 3300009180|Ga0114979_10239482 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
| 3300009182|Ga0114959_10161400 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300009184|Ga0114976_10498455 | Not Available | 628 | Open in IMG/M |
| 3300009419|Ga0114982_1198523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300010158|Ga0114960_10089476 | Not Available | 1733 | Open in IMG/M |
| 3300010158|Ga0114960_10369296 | Not Available | 706 | Open in IMG/M |
| 3300010160|Ga0114967_10016253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5360 | Open in IMG/M |
| 3300010334|Ga0136644_10088301 | Not Available | 1941 | Open in IMG/M |
| 3300010334|Ga0136644_10114081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1670 | Open in IMG/M |
| 3300010334|Ga0136644_10259304 | Not Available | 1018 | Open in IMG/M |
| 3300010885|Ga0133913_11147399 | Not Available | 1997 | Open in IMG/M |
| 3300010885|Ga0133913_11265626 | Not Available | 1887 | Open in IMG/M |
| 3300010885|Ga0133913_11336420 | Not Available | 1828 | Open in IMG/M |
| 3300010885|Ga0133913_11831947 | Not Available | 1517 | Open in IMG/M |
| 3300011335|Ga0153698_1453 | Not Available | 17107 | Open in IMG/M |
| 3300012006|Ga0119955_1002229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9364 | Open in IMG/M |
| 3300013006|Ga0164294_10027805 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46 | 4555 | Open in IMG/M |
| 3300013006|Ga0164294_10235014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1287 | Open in IMG/M |
| 3300013014|Ga0164295_11565587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300013286|Ga0136641_1037641 | Not Available | 1437 | Open in IMG/M |
| 3300013372|Ga0177922_10135935 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED46 | 1716 | Open in IMG/M |
| 3300017722|Ga0181347_1056413 | Not Available | 1178 | Open in IMG/M |
| 3300017761|Ga0181356_1012807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3169 | Open in IMG/M |
| 3300017761|Ga0181356_1069045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1189 | Open in IMG/M |
| 3300017761|Ga0181356_1110378 | Not Available | 887 | Open in IMG/M |
| 3300017778|Ga0181349_1030194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2183 | Open in IMG/M |
| 3300018417|Ga0181558_10625251 | Not Available | 552 | Open in IMG/M |
| 3300019093|Ga0187843_10032647 | Not Available | 2595 | Open in IMG/M |
| 3300019093|Ga0187843_10178483 | Not Available | 909 | Open in IMG/M |
| 3300019784|Ga0181359_1010037 | Not Available | 3348 | Open in IMG/M |
| 3300019784|Ga0181359_1014817 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosopelagicus → unclassified Candidatus Nitrosopelagicus → Candidatus Nitrosopelagicus sp. | 2872 | Open in IMG/M |
| 3300019784|Ga0181359_1184959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300022190|Ga0181354_1162200 | Not Available | 692 | Open in IMG/M |
| 3300022190|Ga0181354_1221303 | Not Available | 553 | Open in IMG/M |
| 3300022407|Ga0181351_1065785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1480 | Open in IMG/M |
| 3300022407|Ga0181351_1113205 | Not Available | 1029 | Open in IMG/M |
| 3300023174|Ga0214921_10049477 | Not Available | 3723 | Open in IMG/M |
| 3300023184|Ga0214919_10001031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 46982 | Open in IMG/M |
| 3300023184|Ga0214919_10005625 | Not Available | 17645 | Open in IMG/M |
| 3300023184|Ga0214919_10019525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7655 | Open in IMG/M |
| 3300023184|Ga0214919_10034207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5209 | Open in IMG/M |
| 3300023184|Ga0214919_10077569 | All Organisms → Viruses → Predicted Viral | 2954 | Open in IMG/M |
| 3300023184|Ga0214919_10610622 | Not Available | 641 | Open in IMG/M |
| 3300023184|Ga0214919_10784606 | Not Available | 523 | Open in IMG/M |
| 3300024346|Ga0244775_10216877 | Not Available | 1602 | Open in IMG/M |
| 3300025436|Ga0208103_1030473 | Not Available | 742 | Open in IMG/M |
| 3300025578|Ga0208864_1132127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
| 3300025595|Ga0208248_1002758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4702 | Open in IMG/M |
| 3300027581|Ga0209651_1028595 | Not Available | 1724 | Open in IMG/M |
| 3300027642|Ga0209135_1258047 | Not Available | 514 | Open in IMG/M |
| 3300027708|Ga0209188_1000843 | Not Available | 27255 | Open in IMG/M |
| 3300027708|Ga0209188_1017015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3838 | Open in IMG/M |
| 3300027708|Ga0209188_1110562 | All Organisms → Viruses → Predicted Viral | 1087 | Open in IMG/M |
| 3300027733|Ga0209297_1000064 | Not Available | 80714 | Open in IMG/M |
| 3300027734|Ga0209087_1037000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2300 | Open in IMG/M |
| 3300027734|Ga0209087_1038085 | Not Available | 2261 | Open in IMG/M |
| 3300027734|Ga0209087_1054216 | Not Available | 1820 | Open in IMG/M |
| 3300027734|Ga0209087_1315335 | Not Available | 552 | Open in IMG/M |
| 3300027736|Ga0209190_1001442 | Not Available | 16610 | Open in IMG/M |
| 3300027736|Ga0209190_1020781 | All Organisms → Viruses → Predicted Viral | 3686 | Open in IMG/M |
| 3300027736|Ga0209190_1031031 | Not Available | 2865 | Open in IMG/M |
| 3300027736|Ga0209190_1199430 | Not Available | 826 | Open in IMG/M |
| 3300027741|Ga0209085_1017671 | Not Available | 3465 | Open in IMG/M |
| 3300027741|Ga0209085_1197263 | Not Available | 820 | Open in IMG/M |
| 3300027747|Ga0209189_1069259 | Not Available | 1650 | Open in IMG/M |
| 3300027749|Ga0209084_1008200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6618 | Open in IMG/M |
| 3300027749|Ga0209084_1010594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5598 | Open in IMG/M |
| 3300027749|Ga0209084_1013390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4764 | Open in IMG/M |
| 3300027749|Ga0209084_1059185 | Not Available | 1808 | Open in IMG/M |
| 3300027749|Ga0209084_1246232 | Not Available | 697 | Open in IMG/M |
| 3300027770|Ga0209086_10001246 | Not Available | 20852 | Open in IMG/M |
| 3300027770|Ga0209086_10383488 | Not Available | 570 | Open in IMG/M |
| 3300027782|Ga0209500_10038037 | Not Available | 2657 | Open in IMG/M |
| 3300027797|Ga0209107_10005814 | Not Available | 6944 | Open in IMG/M |
| 3300027797|Ga0209107_10024595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3460 | Open in IMG/M |
| 3300027899|Ga0209668_10611465 | Not Available | 728 | Open in IMG/M |
| 3300027963|Ga0209400_1226963 | Not Available | 756 | Open in IMG/M |
| 3300027969|Ga0209191_1009750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5140 | Open in IMG/M |
| 3300027969|Ga0209191_1039214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2223 | Open in IMG/M |
| 3300027969|Ga0209191_1183283 | Not Available | 834 | Open in IMG/M |
| 3300027971|Ga0209401_1008579 | Not Available | 5838 | Open in IMG/M |
| 3300028393|Ga0304728_1034014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2210 | Open in IMG/M |
| 3300031758|Ga0315907_10018631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6501 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 56.25% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 7.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.91% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.56% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.56% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.78% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.78% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.78% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
| 3300004772 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004790 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004804 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0M | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025578 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300025595 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25908J49247_100960984 | 3300003277 | Freshwater Lake | MFVGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIARKTW* |
| JGI25926J51410_10756131 | 3300003490 | Freshwater Lake | MFFIGLMGVDNDGKTMYTPSGTKIFFTLPWGLAWRVQEIQHWIARKTW* |
| Ga0065167_10390811 | 3300004693 | Freshwater | MFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWKVQEIQHWIAKKTW* |
| Ga0007791_101403701 | 3300004772 | Freshwater | MFIGLMGVDNDGKTMYTPSGDRIGFTLPWGLAWQVQRIQHWIARKTWR* |
| Ga0007794_100074331 | 3300004774 | Freshwater | MFIGLMGVDNDGKTMYTPNGNKIWFTLPWGLAWKLQEIQHWIAKKTWR* |
| Ga0007794_102242141 | 3300004774 | Freshwater | MFVGLMGVDSNGKTMYTPSGNRIWFTLPWGLAWQVQRIQHWIARKTWR* |
| Ga0007758_112328844 | 3300004790 | Freshwater Lake | MFFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIARKTW* |
| Ga0007761_100485471 | 3300004792 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIARKTW* |
| Ga0007796_1001017710 | 3300004804 | Freshwater | MFVGLMGVDGDGKTMYTPSGNRIWFTLPWGLAWQVQEIQHWIA |
| Ga0007796_101912091 | 3300004804 | Freshwater | MFVGLIGVDNDGKTMYSPSGTKIFFTLPGGLAWQVQRIQHWIARKTWR* |
| Ga0007792_102824841 | 3300004805 | Freshwater | MFFIGLMGVDNDGKTMYTPNGTKIFFKLPWGLAWKIQEIQHWIAKKTW* |
| Ga0068876_105697421 | 3300005527 | Freshwater Lake | LKEFKMFIGLMGVDNDGKTMYTPSGKKIFFTLPWGLAWKVQQIQHWIAQKTWR* |
| Ga0078894_116438941 | 3300005662 | Freshwater Lake | MFIGLMGVDSDGKTMYTPNGTKIFFTLPGGLAWQVQRIQHWIARRTWR* |
| Ga0079301_10832751 | 3300006639 | Deep Subsurface | FIGLMGVDNDGKTMYTPSGNRIWFTLPWGLAWRVQEVQHWIARKTWK* |
| Ga0102919_11433623 | 3300007597 | Estuarine | MFVGLMGVDNDGKTMYTSSGEKIWFTLPWGLAWRVQRIQHWIAKKTW* |
| Ga0114973_100112488 | 3300009068 | Freshwater Lake | MFIGLMGVDNDGKTMYAPNGNKIFFTLPGGLAWQVQRIQHWIARKTW* |
| Ga0114973_104255703 | 3300009068 | Freshwater Lake | MFIGLMGVDGDGKTMYTPSGNRIWFALPWGLAWQVQRIQHWIARKTWR* |
| Ga0114962_100135676 | 3300009151 | Freshwater Lake | MFIGLMGVDGDGKTMYTPSGNRVWFTLPWGLAWQVQRIQHWIARKTWR* |
| Ga0114962_100274495 | 3300009151 | Freshwater Lake | MFIGLMGVDNDGQTMYTPNGTKIFFTLPWGLAWNVQRIQHWIAQKTWR* |
| Ga0114962_100358493 | 3300009151 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGEKIFFTLPWGLAWRAQEIQHWIAKKTW* |
| Ga0114962_100398868 | 3300009151 | Freshwater Lake | MFIGLMGVDNDGRTMYTPSGTKIFFTLPGGLAWQVQRIQHWIARKTWR* |
| Ga0114962_100579985 | 3300009151 | Freshwater Lake | MFIGLMGVDNDGKIMYTPNGTKIFFTLPWGLAWRVQEIQHWIAKKTWR* |
| Ga0114962_100695281 | 3300009151 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNKIFFTLPGGLAWRVQELQHWIAKKTW* |
| Ga0114962_100885943 | 3300009151 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWRVQEIQHWIAKKTW* |
| Ga0114962_101309072 | 3300009151 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFRLPWGLAWRVQEIQHWIAKKTW* |
| Ga0114962_103817401 | 3300009151 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWNVQRIQHWIARKTWR* |
| Ga0114962_104917183 | 3300009151 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFKLPKGLAWKVQEIQHWIAKKTW* |
| Ga0114962_106823722 | 3300009151 | Freshwater Lake | MLFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIAKKTWR* |
| Ga0114980_101628281 | 3300009152 | Freshwater Lake | MFIGLMGVDNDGKTMYTPSGNKIFFTLPQGLAWRVQEIQHWIAKKTWR* |
| Ga0114977_100028362 | 3300009158 | Freshwater Lake | MFVGLMGVDNDGKTMYTPSGNKIFFTLPWGLAWRVQEIQHWIARKTWR* |
| Ga0114977_100369543 | 3300009158 | Freshwater Lake | LIKGELMFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWKLQEIQHWIAKKTW* |
| Ga0114977_101754935 | 3300009158 | Freshwater Lake | MFIGLMGVDGDGKTMYTPNGNRIWFTLPGGLAWRVQRIQHWIARNTW |
| Ga0114978_100623783 | 3300009159 | Freshwater Lake | MFVGLMGVDNDGKTMYTPNGNRIFFTLPWGLAWQVQRIQHWIARNTWR* |
| Ga0114978_103291051 | 3300009159 | Freshwater Lake | MFIGLMGVDSDGKTMYTPNGNKIFFTLPWGLAWQVQEIQHWIAKKTWR* |
| Ga0114966_1000034251 | 3300009161 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWRVQELQHWIAKKTW* |
| Ga0114966_106381211 | 3300009161 | Freshwater Lake | MFIGLMGIDNDGKTMYTPNGTKIFFTLPWGLAWKVQRIQHCIAQKTWR* |
| Ga0114970_100151995 | 3300009163 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWKVQEIQHWIAKKTWR* |
| Ga0114970_100376969 | 3300009163 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFTLPRGLAWRVQRIQHWIARKTW* |
| Ga0114970_100418717 | 3300009163 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNKIFFTLPGGLAWNVQQIQHWIARKTWR* |
| Ga0114970_103295622 | 3300009163 | Freshwater Lake | MFIGLMGVDSDGKTMYTPDGTKIFFTLPWGLAWRVQEIQHWIAKKTWR* |
| Ga0114975_100460625 | 3300009164 | Freshwater Lake | MFIGLMGVDGDGKTMYTPSGNRIFFTLPWGLAWRVQEIQHCIARKTWR* |
| Ga0114975_100671623 | 3300009164 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWKLQEIQHWIAKKTW* |
| Ga0114975_101368362 | 3300009164 | Freshwater Lake | MFIGLMGVDSDGKTMYTPNGNRIFFTLPWGLAWRVQAIQHWIARKTWR* |
| Ga0114975_105241702 | 3300009164 | Freshwater Lake | MFIGLMGVDNDGKTMYTPSGNKIFFTLPWGLAWRVQEIQHWIAKKTWR* |
| Ga0114975_105860021 | 3300009164 | Freshwater Lake | MFIGLMGVDNDGETMYTPSGTKIFFKLPWGLAWRVQEIQHWIAKKTWR* |
| Ga0114979_102394827 | 3300009180 | Freshwater Lake | MFIGLMGVDNDGRTMYTPSGNRIWFTLPWGLAWQVQRIQHWI |
| Ga0114959_101614002 | 3300009182 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFRLPWGLAWKVQEIQHWIAKKTW* |
| Ga0114976_104984552 | 3300009184 | Freshwater Lake | MFIGLMGVDGDGKTMYTPNGNRIWFTLPGGLAWRVQEIQHWIARKTWR* |
| Ga0114982_11985233 | 3300009419 | Deep Subsurface | MFIGLMGVDNDGKTMYTPNGSKIFFTLPWGLAWQVQRIQ |
| Ga0114960_100894768 | 3300010158 | Freshwater Lake | MFVGLMGVDNDGKTMYTPNGNRIWFTLPWGLAWQVQRIQHWI |
| Ga0114960_103692961 | 3300010158 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFKLPWGLAWRVQEIQHWIAKKTW* |
| Ga0114967_1001625312 | 3300010160 | Freshwater Lake | MFVGLMGVDSDGKTMYTPSGTKIWFTLPGGLAWQVQRIQHWIARKTWR* |
| Ga0136644_100883011 | 3300010334 | Freshwater Lake | MFVGLMGVDNDGKTMYSPSGTKIFFTLPGGLAWQVQRIQHWIARKTWR* |
| Ga0136644_101140815 | 3300010334 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNRIGFTLPWGLAWNVQRIQHWIAKKTW* |
| Ga0136644_102593042 | 3300010334 | Freshwater Lake | GDCMFIGLMGVDGDGRTMYTPSGTKIFFTLPWGLAWRVQEIQHWIARKTWR* |
| Ga0133913_111473991 | 3300010885 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWKVQRIQHC |
| Ga0133913_112656262 | 3300010885 | Freshwater Lake | MFIGLMGVDNDGKTMYTPSGNRIFFTLPWGLAWQVQEIQHWIAKKTWR* |
| Ga0133913_113364202 | 3300010885 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKVWFTLPGGLAWQVQRIQHWIARKTWR* |
| Ga0133913_118319473 | 3300010885 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIWFTLPGGLAWRVQEIQHWIAKKTWR* |
| Ga0153698_145313 | 3300011335 | Freshwater | MFIGLMGVDNDGKTMYTPNGSKIFFTLPWGLAWRVQEIQHWIARKTWR* |
| Ga0119955_10022295 | 3300012006 | Freshwater | MFIGLMGVGGDGKTMYTPNGTKIFFKLPWGLAWKVQEIQHWIAKKTWR* |
| Ga0164294_100278054 | 3300013006 | Freshwater | MFFIGLMGVDNDGKTMYTPSGTKIFFTLPWGLAWQVQEIQHWIARKTWK* |
| Ga0164294_102350142 | 3300013006 | Freshwater | MFIGLMGVDNDGKTMYTPSGNKIWFTLPWGLAWKVQEIQHWIAKKTW* |
| Ga0164295_115655871 | 3300013014 | Freshwater | MFIGLMGVDNDGKTMYTPNGTKIFFTLPGGLAWNVQRIQHWIARKTWR* |
| Ga0136641_10376417 | 3300013286 | Freshwater | MFIGLMGVDNDGRTMYTPDGTKIFFKLPWGLAWQVQAIQHWIARLTWR* |
| Ga0177922_101359353 | 3300013372 | Freshwater | GVDGDGKTMYTPSGNRIGFTLPWGLAWRVQEIQHWIARNTWR* |
| Ga0181347_10564132 | 3300017722 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIARKTW |
| Ga0181356_10128072 | 3300017761 | Freshwater Lake | MFIGLMGVDGDGKTMYTPNGNKIFFTLPWGLAWQVQRIQHWIAWKTWR |
| Ga0181356_10690455 | 3300017761 | Freshwater Lake | MFIGLMGVDNDGETMYTPNGNKIWFTLPWGLAWKVQEIQHWIARKTWR |
| Ga0181356_11103782 | 3300017761 | Freshwater Lake | DMFVGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIARKTWR |
| Ga0181349_10301944 | 3300017778 | Freshwater Lake | MFFIGLMGVDNDGKTMYTPSGTKIWFTLPWGLAWRVQEIQHWIARKTWRS |
| Ga0181558_106252511 | 3300018417 | Salt Marsh | VLTKGEIMFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWQVQRIQHWIAKKTW |
| Ga0187843_100326472 | 3300019093 | Freshwater | MFFIGLMGVDNDGKTMYTPSGTKIFFTLPWGLAWQVQEIQHWIARKTW |
| Ga0187843_101784834 | 3300019093 | Freshwater | MFIGLMGVDNDGKTMYTPSGTKIFFMLPWGLAWRVQEIQHWIARKTWR |
| Ga0181359_10100372 | 3300019784 | Freshwater Lake | MFFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIARKTW |
| Ga0181359_10148172 | 3300019784 | Freshwater Lake | MFVGLMGVDNDGKTMYTPNGSKIFFTLPWGLAWQVQRIQHWIARKTW |
| Ga0181359_11849591 | 3300019784 | Freshwater Lake | MFIGLMGVDNDGKTMYTPSGEKIFFTLPWGLAWQVQRIQHWIAWKTWR |
| Ga0181354_11622001 | 3300022190 | Freshwater Lake | MFIGLMGVDNDGKTMYTPSGTKIWFTLPWGLAWRVQEIQHWLARKTWR |
| Ga0181354_12213035 | 3300022190 | Freshwater Lake | MFFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIARKTWLS |
| Ga0181351_10657851 | 3300022407 | Freshwater Lake | MFIGLMGVDNDGETMYTSNGNKIWFTLPWGLAWKVQEIQHWIARKTWR |
| Ga0181351_11132052 | 3300022407 | Freshwater Lake | MFVGLMGVDGDGKTMYTPSGEKIFFTLPWGLAWRVQEIQHWIARKTWR |
| Ga0214921_100494775 | 3300023174 | Freshwater | MFIGLMGVDNDGKTMYTPSGNKIFFTLPWGLAWRVQRIQHWIAKKTW |
| Ga0214919_100010316 | 3300023184 | Freshwater | MFIGLMGVDSDGKTMYTPSGEKIFFTLPWGLARQAQRIQHWIARKTWR |
| Ga0214919_100056256 | 3300023184 | Freshwater | MFIGLMGVGSDGRTMYTPSGNRIGFTLPWGLAWQVQRIQHWIARKTWR |
| Ga0214919_1001952510 | 3300023184 | Freshwater | MFIGLMGVDNDGKTMYTPSGTKIGFTLPWGLAWQVQRIQHWIARKTWR |
| Ga0214919_100342078 | 3300023184 | Freshwater | MFIGLMGVDNDGKIMYTPNGTKIFFTLPWGLAWQVQEIQHWIAKKTWR |
| Ga0214919_100775696 | 3300023184 | Freshwater | MFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWKVQEIQHWIAKKTW |
| Ga0214919_106106221 | 3300023184 | Freshwater | GVGGDGKTMYTPSGNKIFFTLPWGLAWKVQEIQHWIAKKTW |
| Ga0214919_107846062 | 3300023184 | Freshwater | MFFIGLMGVDNDGKTMYTPNGNKIWFTLPWGLAWKVQEIQHWIAKKTWR |
| Ga0244775_102168773 | 3300024346 | Estuarine | MFVGLMGVDGDGKTMYTPSGTKIWFTLPWGLAWQVQRIQHWIARKTWR |
| Ga0208103_10304731 | 3300025436 | Freshwater | MFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWKVQEIQHWIAKKTW |
| Ga0208864_11321272 | 3300025578 | Freshwater | MFIGLMGVDNDGKTMYTPSGDRIGFTLPWGLAWQVQRIQHWIARKTWR |
| Ga0208248_10027585 | 3300025595 | Freshwater | MFIGLMGVDNDGKTMYTPNGNKIWFTLPWGLAWKLQEIQHWIAKKTWR |
| Ga0209651_10285952 | 3300027581 | Freshwater Lake | MFVGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIARKTW |
| Ga0209135_12580471 | 3300027642 | Freshwater Lake | MFVGLMGVDGDGKTMYTPSGEKIFFTLPWGLARRVQEIQHWIARKTWR |
| Ga0209188_100084320 | 3300027708 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFRLPWGLAWRVQEIQHWIAKKTW |
| Ga0209188_10170153 | 3300027708 | Freshwater Lake | MLFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWRVQEIQHWIAKKTWR |
| Ga0209188_11105621 | 3300027708 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFRLPWGLAWKVQEIQHWIAKKTW |
| Ga0209297_100006464 | 3300027733 | Freshwater Lake | MFVGLMGVDNDGKTMYTPSGNKIFFTLPWGLAWRVQEIQHWIARKTWR |
| Ga0209087_10370003 | 3300027734 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFKLPKGLAWKVQEIQHWIAKKTW |
| Ga0209087_10380852 | 3300027734 | Freshwater Lake | MFIGLMGVDGDGKTMYTPSGNRIFFTLPWGLAWRVQEIQHCIARKTWR |
| Ga0209087_10542163 | 3300027734 | Freshwater Lake | MFIGLMGVDNDGRTMYTPSGNRIWFTLPWGLAWQVQRIQHWIAKKTWR |
| Ga0209087_13153351 | 3300027734 | Freshwater Lake | MFIGLMGVDNDGKTMYTPSGNKIFFTLPQGLAWRVQEIQHWIAKKTWR |
| Ga0209190_100144227 | 3300027736 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFTLPRGLAWRVQRIQHWIARKTW |
| Ga0209190_10207815 | 3300027736 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFTLPWGLAWKVQEIQHW |
| Ga0209190_10310311 | 3300027736 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNKIFFTLPGGLAWNVQQIQHWIARKTWR |
| Ga0209190_11994301 | 3300027736 | Freshwater Lake | CMFIGLMGVDSDGKTMYTPDGTKIFFTLPWGLAWRVQEIQHWIAKKTWR |
| Ga0209085_10176713 | 3300027741 | Freshwater Lake | MFIGLMGVDNDGRTMYTPSGTRIWFTLPWGLAWQVQRIQHWIARKTW |
| Ga0209085_11972632 | 3300027741 | Freshwater Lake | MFIGLMGVDGDGKTMYTPSGNRVWFTLPWGLAWQVQRIQHWIARKTWR |
| Ga0209189_10692594 | 3300027747 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNRIGFTLPWGLAWNVQRIQHWIARKTWR |
| Ga0209084_100820012 | 3300027749 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKVWFTLPGGLAWQVQRIQHWIARKTWR |
| Ga0209084_10105943 | 3300027749 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWRVQEIQHWIAKKTW |
| Ga0209084_10133906 | 3300027749 | Freshwater Lake | MFIGLMGVDNDGQTMYTPNGTKIFFTLPWGLAWNVQRIQHWIAQKTWR |
| Ga0209084_10591851 | 3300027749 | Freshwater Lake | MFIGLMGVDNDGRTMYTPSGTKIFFTLPGGLAWQVQRIQHWIARKTWR |
| Ga0209084_12462321 | 3300027749 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNKIFFTLPGGLAWRVQELQHWIAKKTW |
| Ga0209086_1000124619 | 3300027770 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWRVQELQHWIAKKTW |
| Ga0209086_103834881 | 3300027770 | Freshwater Lake | MFIGLMGIDNDGKTMYTPNGTKIFFTLPWGLAWKVQRIQHCIAQKTWR |
| Ga0209500_100380372 | 3300027782 | Freshwater Lake | MFVGLMGVDNDGKTMYTPNGNRIFFTLPWGLAWQVQRIQHWIARNTWR |
| Ga0209107_100058145 | 3300027797 | Freshwater And Sediment | MFIGLMGVDNDGKTMYTPNGEKIFFTLPWGLAWKVQEIQHWIAKKTW |
| Ga0209107_100245954 | 3300027797 | Freshwater And Sediment | MFIGLMGVDNDGKTMYTPDGTKIWFTLPWGLAWKVQEIQHWIAKKTWR |
| Ga0209668_106114651 | 3300027899 | Freshwater Lake Sediment | MFIGLMGVDNDGKTMYTPNGNKIFFTLPWGLAWRVQRIQHWIAKKTW |
| Ga0209400_12269631 | 3300027963 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGNRIGFTLPWGLAWRVQRIQHWIAKKTW |
| Ga0209191_10097501 | 3300027969 | Freshwater Lake | MFIGLMGVDNDGKTMYTPSGNKIFFTLPWGLAWRVQEIQHWIAKKTWR |
| Ga0209191_10392143 | 3300027969 | Freshwater Lake | MFIGLMGVDSDGKTMYTPNGNRIFFTLPWGLAWRVQAIQHWIARKTWR |
| Ga0209191_11832831 | 3300027969 | Freshwater Lake | MFIGLMGVDNDGKTMYTPSGNRIFFTLPWGLAWQVQEIQHWIAKKTWR |
| Ga0209401_10085791 | 3300027971 | Freshwater Lake | MFVGLMGVDSDGKTMYTPSGTKIWFTLPGGLAWQVQRIQHWIARKTWR |
| Ga0304728_10340141 | 3300028393 | Freshwater Lake | MFIGLMGVDNDGKTMYTPNGTKIFFTLPLGLAWKVQEIQHWIAKKTW |
| Ga0315907_1001863110 | 3300031758 | Freshwater | MFIGLMGVDNDGKTMYTPSGKKIFFTLPWGLAWKVQQIQHWIAQKTWR |
| ⦗Top⦘ |