| Basic Information | |
|---|---|
| Taxon OID | 3300023052 Open in IMG/M |
| Scaffold ID | Ga0233331_1043649 Open in IMG/M |
| Source Dataset Name | Leaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-205 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 530 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Rutstroemiaceae → Rutstroemia → unclassified Rutstroemia → Rutstroemia sp. NJR-2017a WRK4 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 40.2526 | Long. (o) | -123.026 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F106076 | Metagenome / Metatranscriptome | 100 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0233331_10436491 | F106076 | N/A | PWKPVNIKANNTVAVNPYKVPLLFPCIIEXXEYVTVTPEDNNITVLSKGNSKGFIGSIPIGGHXAPNSTVGDNALXKKAQKTPKKNNASDSINKATPIFSPLCTANVXFPKYVPSLITSRHQYDIDNITERKANTITGLAPLKLXKVDTALVVNVNNAIHVYIGQGEGDTKXKGXA |
| ⦗Top⦘ |