Scaffold Ga0224567_104456

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224567_104456

Scaffold Ga0224567_104456

Overview

Basic Information
Taxon OID	3300022727 Open in IMG/M
Scaffold ID	Ga0224567_104456 Open in IMG/M
Source Dataset Name	Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	523
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location Name	Czech Republic: South Bohemian Region
Coordinates	Lat. (^o)	49.0431	Long. (^o)	13.617	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031208	Metagenome / Metatranscriptome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224567_1044562	F031208	N/A	GFLATVKATLFSSYRDKEALRLLDEPQTPVHPLVQIATTNDSLQETRA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.