| Basic Information | |
|---|---|
| Family ID | F031208 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 45 residues |
| Representative Sequence | TVKATLFTGYRDKEALRLLDEPQAPVHPLVQIAPTNDSLQETRA |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.81 % |
| % of genes from short scaffolds (< 2000 bps) | 89.62 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.607 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.208 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.055 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.470 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 0.00% Coil/Unstructured: 84.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF13419 | HAD_2 | 6.01 |
| PF01741 | MscL | 6.01 |
| PF00581 | Rhodanese | 3.28 |
| PF03544 | TonB_C | 1.64 |
| PF04545 | Sigma70_r4 | 1.09 |
| PF16640 | Big_3_5 | 0.55 |
| PF02566 | OsmC | 0.55 |
| PF02768 | DNA_pol3_beta_3 | 0.55 |
| PF00849 | PseudoU_synth_2 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 6.01 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.64 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.55 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.55 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.61 % |
| Unclassified | root | N/A | 16.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001175|JGI12649J13570_1015682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 844 | Open in IMG/M |
| 3300001471|JGI12712J15308_10120725 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101071454 | Not Available | 692 | Open in IMG/M |
| 3300004082|Ga0062384_100119645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1443 | Open in IMG/M |
| 3300004092|Ga0062389_104739414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 512 | Open in IMG/M |
| 3300005332|Ga0066388_106935790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 570 | Open in IMG/M |
| 3300005436|Ga0070713_101344268 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005439|Ga0070711_100406463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1106 | Open in IMG/M |
| 3300005526|Ga0073909_10047998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1538 | Open in IMG/M |
| 3300005533|Ga0070734_10883008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 507 | Open in IMG/M |
| 3300005537|Ga0070730_10678850 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005541|Ga0070733_10340559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 994 | Open in IMG/M |
| 3300005541|Ga0070733_10632167 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005591|Ga0070761_10669221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 649 | Open in IMG/M |
| 3300005602|Ga0070762_10729398 | Not Available | 666 | Open in IMG/M |
| 3300005602|Ga0070762_10792259 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300005610|Ga0070763_10227854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300005610|Ga0070763_10589445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 643 | Open in IMG/M |
| 3300006059|Ga0075017_100131342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1769 | Open in IMG/M |
| 3300006086|Ga0075019_11082048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 520 | Open in IMG/M |
| 3300006162|Ga0075030_100832509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 728 | Open in IMG/M |
| 3300006173|Ga0070716_101163208 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006176|Ga0070765_100680070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 972 | Open in IMG/M |
| 3300006796|Ga0066665_11138558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 594 | Open in IMG/M |
| 3300009137|Ga0066709_100024465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6202 | Open in IMG/M |
| 3300009519|Ga0116108_1203459 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300009623|Ga0116133_1225993 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300009683|Ga0116224_10512864 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300010048|Ga0126373_10739263 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300010048|Ga0126373_13073326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300010339|Ga0074046_10350570 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300010360|Ga0126372_10606720 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300010376|Ga0126381_101998942 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300010379|Ga0136449_100314745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2842 | Open in IMG/M |
| 3300010379|Ga0136449_101722563 | Not Available | 943 | Open in IMG/M |
| 3300010379|Ga0136449_103779834 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010398|Ga0126383_10726833 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300011120|Ga0150983_12142466 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300011120|Ga0150983_16039449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1019 | Open in IMG/M |
| 3300012096|Ga0137389_11477515 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012205|Ga0137362_11096205 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012211|Ga0137377_10708743 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300012212|Ga0150985_109366733 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012350|Ga0137372_10552874 | Not Available | 850 | Open in IMG/M |
| 3300012362|Ga0137361_11741251 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012930|Ga0137407_12212148 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300014501|Ga0182024_12186304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300014654|Ga0181525_10628460 | Not Available | 600 | Open in IMG/M |
| 3300014657|Ga0181522_10551067 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300016404|Ga0182037_11541987 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300017933|Ga0187801_10387455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300017942|Ga0187808_10621367 | Not Available | 501 | Open in IMG/M |
| 3300017955|Ga0187817_10344555 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300017955|Ga0187817_11041188 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300017961|Ga0187778_10409248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 891 | Open in IMG/M |
| 3300017970|Ga0187783_10269969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300017972|Ga0187781_10963842 | Not Available | 623 | Open in IMG/M |
| 3300017975|Ga0187782_10221881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1417 | Open in IMG/M |
| 3300018006|Ga0187804_10484834 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018006|Ga0187804_10598216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300018007|Ga0187805_10386104 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300018026|Ga0187857_10207779 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300018042|Ga0187871_10035806 | All Organisms → cellular organisms → Bacteria | 3076 | Open in IMG/M |
| 3300018042|Ga0187871_10149244 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300018043|Ga0187887_10718022 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300018062|Ga0187784_11439905 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018062|Ga0187784_11481759 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300018088|Ga0187771_10040928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3573 | Open in IMG/M |
| 3300018090|Ga0187770_11120302 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300019270|Ga0181512_1670365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300020581|Ga0210399_10093012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2459 | Open in IMG/M |
| 3300020581|Ga0210399_10800164 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300020582|Ga0210395_10585248 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300021170|Ga0210400_10686296 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300021170|Ga0210400_11645108 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021181|Ga0210388_10918512 | Not Available | 754 | Open in IMG/M |
| 3300021401|Ga0210393_10956257 | Not Available | 694 | Open in IMG/M |
| 3300021402|Ga0210385_10034305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3305 | Open in IMG/M |
| 3300021402|Ga0210385_10071117 | All Organisms → cellular organisms → Bacteria | 2370 | Open in IMG/M |
| 3300021404|Ga0210389_10091208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2342 | Open in IMG/M |
| 3300021404|Ga0210389_10493250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 964 | Open in IMG/M |
| 3300021420|Ga0210394_11142294 | Not Available | 670 | Open in IMG/M |
| 3300021474|Ga0210390_10770314 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300021478|Ga0210402_10194727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1861 | Open in IMG/M |
| 3300021478|Ga0210402_10827985 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300021478|Ga0210402_10863935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300021559|Ga0210409_11340127 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300021858|Ga0213852_1145331 | Not Available | 676 | Open in IMG/M |
| 3300021861|Ga0213853_10883041 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300022722|Ga0242657_1130782 | Not Available | 646 | Open in IMG/M |
| 3300022727|Ga0224567_104456 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300022728|Ga0224566_100687 | All Organisms → cellular organisms → Bacteria | 2575 | Open in IMG/M |
| 3300022731|Ga0224563_1018748 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300023250|Ga0224544_1034475 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300024176|Ga0224565_1004966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1493 | Open in IMG/M |
| 3300024271|Ga0224564_1090559 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300024295|Ga0224556_1055037 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300025527|Ga0208714_1097234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300025939|Ga0207665_11365848 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300026538|Ga0209056_10638371 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300027030|Ga0208240_1039637 | Not Available | 530 | Open in IMG/M |
| 3300027565|Ga0209219_1109585 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300027576|Ga0209003_1034163 | Not Available | 872 | Open in IMG/M |
| 3300027604|Ga0208324_1113400 | Not Available | 752 | Open in IMG/M |
| 3300027619|Ga0209330_1105607 | Not Available | 639 | Open in IMG/M |
| 3300027729|Ga0209248_10159521 | Not Available | 671 | Open in IMG/M |
| 3300027737|Ga0209038_10118853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 800 | Open in IMG/M |
| 3300027767|Ga0209655_10315598 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027783|Ga0209448_10008619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3230 | Open in IMG/M |
| 3300027783|Ga0209448_10020055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2198 | Open in IMG/M |
| 3300027842|Ga0209580_10235208 | Not Available | 911 | Open in IMG/M |
| 3300027854|Ga0209517_10477979 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300027855|Ga0209693_10421739 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300027869|Ga0209579_10418711 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300027869|Ga0209579_10433501 | Not Available | 713 | Open in IMG/M |
| 3300027879|Ga0209169_10306305 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300027889|Ga0209380_10808361 | Not Available | 531 | Open in IMG/M |
| 3300027895|Ga0209624_10788412 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300027905|Ga0209415_10698607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300028047|Ga0209526_10556343 | Not Available | 740 | Open in IMG/M |
| 3300028047|Ga0209526_10583539 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300028747|Ga0302219_10003795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5908 | Open in IMG/M |
| 3300028800|Ga0265338_11204521 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300028874|Ga0302155_10178821 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300028906|Ga0308309_10731391 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300029636|Ga0222749_10773053 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300029907|Ga0311329_10168651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1712 | Open in IMG/M |
| 3300029911|Ga0311361_10389851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1473 | Open in IMG/M |
| 3300029914|Ga0311359_10638741 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300029943|Ga0311340_11305058 | Not Available | 578 | Open in IMG/M |
| 3300029944|Ga0311352_11243659 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300029955|Ga0311342_10337281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1346 | Open in IMG/M |
| 3300030045|Ga0302282_1273243 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300030057|Ga0302176_10437740 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300030399|Ga0311353_10358626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1321 | Open in IMG/M |
| 3300030503|Ga0311370_10058270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5639 | Open in IMG/M |
| 3300030509|Ga0302183_10094577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
| 3300030518|Ga0302275_10247745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1016 | Open in IMG/M |
| 3300030618|Ga0311354_11076738 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300030646|Ga0302316_10088194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1333 | Open in IMG/M |
| 3300030740|Ga0265460_12495908 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300030743|Ga0265461_10839748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 870 | Open in IMG/M |
| 3300030862|Ga0265753_1049281 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300030991|Ga0073994_10053250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1248 | Open in IMG/M |
| 3300030991|Ga0073994_12061375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 764 | Open in IMG/M |
| 3300031057|Ga0170834_107413355 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031122|Ga0170822_16555770 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031234|Ga0302325_12844143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300031236|Ga0302324_101082537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1080 | Open in IMG/M |
| 3300031344|Ga0265316_10914099 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300031446|Ga0170820_12051010 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031708|Ga0310686_105944320 | Not Available | 554 | Open in IMG/M |
| 3300031708|Ga0310686_108901880 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031715|Ga0307476_11139398 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031718|Ga0307474_11057570 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300031753|Ga0307477_10046390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2987 | Open in IMG/M |
| 3300031753|Ga0307477_10701181 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031753|Ga0307477_11049513 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031754|Ga0307475_10144434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1886 | Open in IMG/M |
| 3300031754|Ga0307475_10402554 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300031754|Ga0307475_11385347 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300031823|Ga0307478_10283570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1353 | Open in IMG/M |
| 3300031823|Ga0307478_10738856 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300031837|Ga0302315_10135192 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300031866|Ga0316049_111144 | Not Available | 657 | Open in IMG/M |
| 3300031912|Ga0306921_10520440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1382 | Open in IMG/M |
| 3300031946|Ga0310910_10529734 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300031962|Ga0307479_11316615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300032782|Ga0335082_10037977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5074 | Open in IMG/M |
| 3300032783|Ga0335079_11263977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300032828|Ga0335080_10269275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1857 | Open in IMG/M |
| 3300032829|Ga0335070_10437727 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300032892|Ga0335081_12694889 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032893|Ga0335069_10581534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 1287 | Open in IMG/M |
| 3300033134|Ga0335073_10833341 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300033134|Ga0335073_11543930 | Not Available | 637 | Open in IMG/M |
| 3300033405|Ga0326727_10451983 | Not Available | 1145 | Open in IMG/M |
| 3300033405|Ga0326727_11247211 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300034163|Ga0370515_0489957 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.01% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.46% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.37% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.37% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.92% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.28% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.28% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.19% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.64% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.64% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.64% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.09% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.09% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.09% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.09% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.55% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.55% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.55% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.55% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022727 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3 | Environmental | Open in IMG/M |
| 3300022728 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031866 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12649J13570_10156822 | 3300001175 | Forest Soil | TVKATLFTGYRDKEALRLLDEPQAPVHPLVQIAPTNDSLQETRA* |
| JGI12269J14319_100538641 | 3300001356 | Peatlands Soil | TGYRDDEALHMLEEPQAPVHPLIQIEPPSETASLQQTRA* |
| JGI12712J15308_101207252 | 3300001471 | Forest Soil | LFSRYRDDEALRLLDEPQAAVNPLVQIATPESLHETRA* |
| JGIcombinedJ26739_1010714541 | 3300002245 | Forest Soil | LFSRYRDEEAMRLLDEPQAAVHPLVQISTADESMQETRA* |
| Ga0062384_1001196451 | 3300004082 | Bog Forest Soil | KATLFTSYRDKEALRLLDEHQAPVHPLVQIAPTDESMQETRA* |
| Ga0062389_1047394141 | 3300004092 | Bog Forest Soil | LFDGYRDEEALRLLDEPQAPVHPLVQIAPTNDSLHETRA* |
| Ga0066388_1069357902 | 3300005332 | Tropical Forest Soil | TVKAMLFTKYKDEEALRMLEEPPVPVHPLIQITPLVGHSPDLEQSRA* |
| Ga0070713_1013442681 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ATLFTSYKDEEALKMLEEPPAPVHPLIQIAPNANAPHTLHEARTT* |
| Ga0070711_1004064633 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FSSLEGFLATVKGTLFSSYKDEAALRLLDEPQAPAHPLVQIAPTTESADALQETRA* |
| Ga0073909_100479983 | 3300005526 | Surface Soil | FSSLGGFLATVKATLSTSYKDDEALRMLEEPQAPVNPLIQINPTAESLHESRA* |
| Ga0070734_108830081 | 3300005533 | Surface Soil | SSLGGFLATVKGTLFPGYRDEAALRMLEEPTSAVNPLVQIATPTAQAESLQETRA* |
| Ga0070730_106788501 | 3300005537 | Surface Soil | FSSLGGFLATVKATLSTSYKDKEALKMLEEPQAPVNPLIQISPTKNAGSTLQETRA* |
| Ga0070733_103405591 | 3300005541 | Surface Soil | GFLATVKATLFSRYRDPAALRMLEEPEAAVHPLVQISPTSNSSHLQETSV* |
| Ga0070733_106321672 | 3300005541 | Surface Soil | SLGGFLATVKATLFTRYRDEEALRLLEEPQAPVHPLVQIAPTNDSLQETRA* |
| Ga0070761_106692211 | 3300005591 | Soil | LEGFLATVKATLFDGYRDEEALRLLDEPQAPVHPLVQIATTSEPLHETRA* |
| Ga0070762_107293983 | 3300005602 | Soil | GYRDEEALRLLDEPQAPVHPLVQIAPTNDSLQQTRA* |
| Ga0070762_107922591 | 3300005602 | Soil | VKATLFDGYRDEEALRLLDEPQAPVHPLVQISPTDDSSHAWQGTQA* |
| Ga0070763_102278543 | 3300005610 | Soil | DGYRDEEALRLLDEPQAPVHPLVQIATNDSLQETRA* |
| Ga0070763_105894452 | 3300005610 | Soil | VKATLFDGYRDEEALRLLDEPQAPVHPLVQIATTSEPLHETRA* |
| Ga0075017_1001313424 | 3300006059 | Watersheds | TVKATLFTSYKDKEALKMLEEPQAPVNPLIQIAPPSDRLQETRA* |
| Ga0075019_110820481 | 3300006086 | Watersheds | FLATVKATLFTSYKDEEALRMLDAPQAPVNPLIQISTPVAQSHNLEESRA* |
| Ga0075030_1008325092 | 3300006162 | Watersheds | VKATLFTSYKDKEALRMLEEPQAPVNPLIQIAPSSAQSHSLQETRA* |
| Ga0070716_1011632082 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RDDEALRMLEEPQAPVNPLIQIAPSSAQEHSLQETRA* |
| Ga0070765_1006800701 | 3300006176 | Soil | VKATLFTGYRDEEALRLLDEPQAPVHPLVQIAPTASSLEETRV* |
| Ga0066665_111385581 | 3300006796 | Soil | ATRFTSYRDEEALRLLDEPAAPVHPLVQIATPNDSLQETRA* |
| Ga0066709_1000244658 | 3300009137 | Grasslands Soil | LATVKATLFTSYRDEEALRLLDEPAAPVHPLVQIATPNDSLQETRA* |
| Ga0116108_12034592 | 3300009519 | Peatland | TVKATLFTSYRDKEALRLLDEPQAPVHPLVQIASTTEPLHETRA* |
| Ga0116133_12259932 | 3300009623 | Peatland | VKATLFSRYPDSAALHMLEEPQAAVHPLVQISPTSNSSPLQETSV* |
| Ga0116224_105128642 | 3300009683 | Peatlands Soil | GGFLATVKATLFSSYRDEEALRLLEEPQAPVNPLVQIMPNAEPAQSLQETRA* |
| Ga0126373_107392631 | 3300010048 | Tropical Forest Soil | GFLATVKATLFNKYKDEEALRMLEEPTAPIHPLIQITPAESHLEETRA* |
| Ga0126373_130733262 | 3300010048 | Tropical Forest Soil | ATLFTSYKDEEALKMLDEPQAPIHPLIQIAPTQGAQHNLQETRA* |
| Ga0074046_103505703 | 3300010339 | Bog Forest Soil | SSLGGFLATVKATLFSTYRDEGALRLLEEPQTPVHPLVQIQPNAEPTRSLQETGA* |
| Ga0126372_106067202 | 3300010360 | Tropical Forest Soil | FMATVKATLFTGYKDEGALRLLQEPAAPVHSPLVQINSATESLEETRA* |
| Ga0126381_1019989422 | 3300010376 | Tropical Forest Soil | IGAFLATVKATLFTSYKDEEALRMLDEPEAPVNPLIQITPTAESLHESRA* |
| Ga0136449_1003147455 | 3300010379 | Peatlands Soil | ATVKGTLFPRYRDEEALRMLEEPVAAVHPLVQIEAASETLQETRA* |
| Ga0136449_1017225632 | 3300010379 | Peatlands Soil | LATVKATLFTGYRDDEALHMLEEPQAPVHPLIQIEPPSETASLQQTRA* |
| Ga0136449_1037798341 | 3300010379 | Peatlands Soil | KATLFSRYRDEEALRMLEEPVAAVHPLVQIAATAQAESLQETRV* |
| Ga0126383_107268331 | 3300010398 | Tropical Forest Soil | FTGYQDQEALRMLEEPEAPVHPLIQISRTAESLHESRA* |
| Ga0150983_121424662 | 3300011120 | Forest Soil | ATVKATLFTRYRDEEALRLLEEHQAPVNPLVQIAPTSDSSLQGTRA* |
| Ga0150983_160394493 | 3300011120 | Forest Soil | GGFLATVKGTLFSRYRDDEALRLLEEPPAAVHPLVQIRTADESLQETRA* |
| Ga0137389_114775152 | 3300012096 | Vadose Zone Soil | KATLFSSYRDEEALHLLEEHQAPVHPLVQIAPTNEALHETRA* |
| Ga0137362_110962051 | 3300012205 | Vadose Zone Soil | VKATLFSGYRDEEALRLLDEHQAPVNPLIQIAPTNDSLQETRA* |
| Ga0137377_107087432 | 3300012211 | Vadose Zone Soil | GFLATVKGTLFPRYRDEEALRLLEEPVAAVHPLVQIATPNDSLQETRA* |
| Ga0150985_1093667332 | 3300012212 | Avena Fatua Rhizosphere | LFTSYKDEEALRMLEEPEAPVNPLIQISPTTSHDLQQTRA* |
| Ga0137372_105528741 | 3300012350 | Vadose Zone Soil | KGTLFPRYRDGEALRLLEEPPAAVHPLVQIAAADESMQETRA* |
| Ga0137361_117412511 | 3300012362 | Vadose Zone Soil | FSSYRDEEALRLLEEHQAPVHPLVQIAPTRDSLQETRA* |
| Ga0137407_122121482 | 3300012930 | Vadose Zone Soil | VKATLFSSYRDEAALKMLDEPEAPVHPLVQISAPSDSLQETRP* |
| Ga0182024_121863041 | 3300014501 | Permafrost | YRDDEALRLLDEPQAAVHPLVQIAVPDESMQETRA* |
| Ga0181525_106284601 | 3300014654 | Bog | RYRDEEALRLLDEPQAPVHPLVQIATNDSMQETRA* |
| Ga0181522_105510672 | 3300014657 | Bog | FTRYRDKEALRMLDEHIAPVHPLVQISPTTEPQETRA* |
| Ga0182037_115419872 | 3300016404 | Soil | TLFTRYKDEEALRMLEEPQAPIHPLIQISPTAESLHESRA |
| Ga0187801_103874552 | 3300017933 | Freshwater Sediment | FSSLSGFLATVKATLFTSYKDEEALRMLDAPEAPVNPLIQIAPSPNASQSLQETRA |
| Ga0187808_106213672 | 3300017942 | Freshwater Sediment | LATVKGTLFPRYRDDEALRMLEEPVAAVHPLVQIATAETLQETRA |
| Ga0187817_103445553 | 3300017955 | Freshwater Sediment | SLGGFLATVKATLFTRYRDPEALRLLDEPPAPVHPLVQITTNEPLQETRA |
| Ga0187817_110411881 | 3300017955 | Freshwater Sediment | TFSSLVGFLATVKATLFTRYRDEEALRLLDEPQAPVNPLVQIAPPRESLQETRA |
| Ga0187778_104092481 | 3300017961 | Tropical Peatland | LATVKATLFTAYRDDEAVRMLEEPQAPVNPLIQITPTAEPLQETRA |
| Ga0187783_102699691 | 3300017970 | Tropical Peatland | YKDDEALRMLDEPQAPVHPLIQIAPTPESPSLQETGA |
| Ga0187781_109638421 | 3300017972 | Tropical Peatland | FLATVKATLFTRYRDKDALRMLEEPPAPLHQLVQIAPGTAQSLNETNV |
| Ga0187782_102218813 | 3300017975 | Tropical Peatland | FTHYKDDEALRMLDAPEAPVNPLIQITPSQSTSHDLQETRA |
| Ga0187804_104848342 | 3300018006 | Freshwater Sediment | SLAGFLATVKATLFTSYHDEEALRLLDEPQAPVHPLVQIATPSESLQETRA |
| Ga0187804_105982161 | 3300018006 | Freshwater Sediment | TYRDEEALRLLDEPQAPVHPLVQIAPTNDSLQETRA |
| Ga0187805_103861041 | 3300018007 | Freshwater Sediment | TAKATLFTTYKDEEALKMLDEPQAPVNPLIQIAPSQSQSHSLQETGA |
| Ga0187857_102077791 | 3300018026 | Peatland | KATLFSSYRDKEALRLLEEHQAPVHPLVQISATNDSLQQTRA |
| Ga0187871_100358065 | 3300018042 | Peatland | LGGFLATVKGTLFSRYRDDEALRMLEEPVAAVNPLVQIAATHQAESLQETRV |
| Ga0187871_101492441 | 3300018042 | Peatland | LGGFLATVKGTLFSRYRDDEALRMLEEPVAAVNPLVQIAATNETLQETRV |
| Ga0187887_107180221 | 3300018043 | Peatland | ATVKATLFSSYRDEEALRLLDEPQAPVHPLVQIAPTRESSFQETQA |
| Ga0187784_114399052 | 3300018062 | Tropical Peatland | YRDEEALRLLDQPEEPVHPLIQIAPTGEPAQSLQETRV |
| Ga0187784_114817592 | 3300018062 | Tropical Peatland | ATVKATLFTSYRDEEAERMLEERVEPVHPLVQIAPTSEMAQGTRA |
| Ga0187771_100409281 | 3300018088 | Tropical Peatland | TLFTRYKDDDALRLLDAPAAPVHPLVQIAPVTESAQSLQETGA |
| Ga0187770_111203022 | 3300018090 | Tropical Peatland | VGGFPSTVKATLFTRYRDEEALRLLEEPQAPVHPLVQIASPSESLQETQA |
| Ga0181512_16703651 | 3300019270 | Peatland | VKATLFSRYRDDEALRMLDEPVAAVHPLVQIEVPRETLHETQV |
| Ga0210399_100930124 | 3300020581 | Soil | LATVKGTLFPGYRDAEALRMLEEPQAAVYPLVQIAPTTESERTLQETGA |
| Ga0210399_108001642 | 3300020581 | Soil | TGYRDAEALRLLEEPQAPVHPLVQIASTGDSLQETRA |
| Ga0210395_105852481 | 3300020582 | Soil | FLATVKATLFDGYRDEEALRLLDEPQAPVHPLVQIATNDSLQETRA |
| Ga0210400_103985793 | 3300021170 | Soil | SDQAALRMLDEPEAAVHPLVQISPTSNSSHLQETSV |
| Ga0210400_106862963 | 3300021170 | Soil | VKGTLFSRYRDDEALRLLEEPVAAVHPLVQIAATGETLQETRV |
| Ga0210400_116451081 | 3300021170 | Soil | ATVKGTLCSRYRDDEALRLLEEPPAAVHPLVQIRTADESLQETRA |
| Ga0210388_109185121 | 3300021181 | Soil | LFPHYRDEEALRMLEEPQAAVHPLVQIAPGPDHERSLQETGA |
| Ga0210393_109562573 | 3300021401 | Soil | EGFLATVKATLFDGYRDEEALRLLDEPQAPVHPLVQIAPTNDSLQQTRA |
| Ga0210385_100343055 | 3300021402 | Soil | AYRDEEALRMLEEPTSAVHPLVQIAEADRAESLQETRA |
| Ga0210385_100711175 | 3300021402 | Soil | KATLFDSYRDEEALRVLDEPQAPVHPLVQIATNDSLQETRA |
| Ga0210389_100912084 | 3300021404 | Soil | SSLSGFLATVKGTLFPHYRDEEALRMLEEPQAAVHPLVQIAPGPDHERSLQETGA |
| Ga0210389_104932503 | 3300021404 | Soil | NATFRTLGGFLATVKATLFTSYKDQEALKMLDEPQAPVNPLIQIAPPTDTLQETRA |
| Ga0210383_107043551 | 3300021407 | Soil | SRYSDQAALRMLDEPEAAVHPLVQISPTSNSSHLQETSV |
| Ga0210394_111422942 | 3300021420 | Soil | TLFPGYRDAEALRMLEEPQAAVYPLVQIAPTTESERTLQETGA |
| Ga0210390_107703141 | 3300021474 | Soil | VKGTLFSRYRDDEALRLLEEPVAAVHPLVQIASTGETLQETRV |
| Ga0210402_101947271 | 3300021478 | Soil | GFLATVKGTLFSSYKDEAALRLLDEPQAPAHPLVQIAPTTESAESLQETRA |
| Ga0210402_108279853 | 3300021478 | Soil | TVKATLFSSYRDEEALRLLEEHQAPVNPLIQIAPTSDSLQETRA |
| Ga0210402_108639351 | 3300021478 | Soil | TFSSFGGFLATVKATLFSGYRDDAALKMLDEPVAPVHPLVQISTPSSMHETRV |
| Ga0210409_113401272 | 3300021559 | Soil | RDEEALRMLEEPAAAVHPLVQIAATDRAESLQETRA |
| Ga0213852_11453312 | 3300021858 | Watersheds | KGTLFTSYKDEAALRLLDEPQAPAHPLVQIASTESSQSLQETRA |
| Ga0213853_108830412 | 3300021861 | Watersheds | VKGTLFTSYKDEAALRLLDEPQAPAHPLVQIASTESSQSLQETRA |
| Ga0242657_11307821 | 3300022722 | Soil | FLATVKGTLFPAYRDEEAVRLLEEPVAAVNPLVQIAEAGETLQETRV |
| Ga0224567_1044562 | 3300022727 | Plant Litter | GFLATVKATLFSSYRDKEALRLLDEPQTPVHPLVQIATTNDSLQETRA |
| Ga0224566_1006875 | 3300022728 | Plant Litter | SSLEGFLATVKATLFTSYRDKEALRMLEDHVAPVHPLVQIATPDSSHAAQETHA |
| Ga0224563_10187482 | 3300022731 | Soil | TLFTSYRDEEALRLLDEPQAPVHPLVQIAPTASSLQETRV |
| Ga0224544_10344752 | 3300023250 | Soil | TLFPSYRDEEALRLLDEPQAPVHPLVQIATTNQPLEETRA |
| Ga0224565_10049661 | 3300024176 | Plant Litter | SLGGFLATVKGTLFSRYRDEEALRMLEEPVAAVHPLVQIEAPDALQGTRA |
| Ga0224564_10905592 | 3300024271 | Soil | RYRDEEALRLLEEPQAPVNPLVQIARPRESLQETRA |
| Ga0224556_10550373 | 3300024295 | Soil | KEALRMLEEHQAPVHPLVQIAATSTSLHETRLRETRA |
| Ga0208714_10972342 | 3300025527 | Arctic Peat Soil | GTLFPAYRDDEALRMLEEPQAAVHPLVQIAPTTESAEALQETRA |
| Ga0207665_113658482 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ATLFTSYKDEEALRMLEEPQAPVNPLIQIAPTQNASDSLQETRA |
| Ga0209056_106383711 | 3300026538 | Soil | TSYRDEEALRLLDEPAAPVHPLVQIATPNDSLQETRA |
| Ga0208240_10396371 | 3300027030 | Forest Soil | LFSRYRDDEALRLLEEPVAAVHPLVQIAATGETLQETRV |
| Ga0209219_11095852 | 3300027565 | Forest Soil | FTTYRDEEALRLLDEPQAPVHPLVQIASTNESLQETRA |
| Ga0209003_10341633 | 3300027576 | Forest Soil | TLFTRYRDDEALRMLEDPQAAVHPLVQISAVDESMQETRV |
| Ga0208324_11134001 | 3300027604 | Peatlands Soil | ATFNSIGGFLATVKGTLFPRYRDEEALRMLEEPVAAVHPLVQIEAASETLQETRA |
| Ga0209330_11056071 | 3300027619 | Forest Soil | KGTLFTSYRDEEALRLLDEPAAPVHPLVQIAPPSESMQGTHV |
| Ga0209248_101595212 | 3300027729 | Bog Forest Soil | SLEGFLATVKATLFDGYRDEEALRLLDEPQAPVHPLVQIAPTSEPLHETRA |
| Ga0209038_101188532 | 3300027737 | Bog Forest Soil | VDAIYSSFGGFFATVKATLFTRYRDEEALRLLDEPQAPVHPLVQIATNDSLQETRA |
| Ga0209655_103155982 | 3300027767 | Bog Forest Soil | KATLFTSYRDKEALRLLDEHQAPVHPLVQIAPTDESMQETRA |
| Ga0209448_100086195 | 3300027783 | Bog Forest Soil | GYRDEEALRLLDEPQAPVHPLVQIATNDSLQETRV |
| Ga0209448_100200551 | 3300027783 | Bog Forest Soil | SSLGGFVATVKGTLFPAYRDEEALGMLEEPVAAVHPLVQISTTTESQTLQETRA |
| Ga0209580_102352081 | 3300027842 | Surface Soil | LFTRYRDDEALGMLDEPVAAVHPLVQISAIDESMQETRV |
| Ga0209517_104779791 | 3300027854 | Peatlands Soil | TVKATLFTGYRDDEALHMLEEPQAPVHPLIQIEPPSETASLQQTRA |
| Ga0209693_104217392 | 3300027855 | Soil | ATLFDGYRDEEALRLLDEPQAPVHPLVQIATNDSLQETRA |
| Ga0209579_104187112 | 3300027869 | Surface Soil | TAKAYMFTRYPDKEALKMLDEPEAPVNPLIQISPTQQSASHNLQETRA |
| Ga0209579_104335011 | 3300027869 | Surface Soil | LFTGYRDKEALRLLDEPPAPIHPLVQIAATNDSLQETRA |
| Ga0209169_103063051 | 3300027879 | Soil | GYRDEEALRLLDEPQAPVHPLVQIAPTNDSLQQTRA |
| Ga0209380_108083611 | 3300027889 | Soil | FSRYRDDEALRMLEEPVAAVNPLVQIAVPEQSLHETRV |
| Ga0209624_107884122 | 3300027895 | Forest Soil | LFPHYRDEEALRLLEEPQAAVHPLVQIAPGPDHERSLQETGA |
| Ga0209415_106986073 | 3300027905 | Peatlands Soil | LFTRYRDEEALRLLDEPQAPVHPLVQIAPTKNSSLQETRA |
| Ga0209526_105563432 | 3300028047 | Forest Soil | ATVKGTLFSRYRDDEALRLLDEPQAAVHPLVQISTADESMQETRA |
| Ga0209526_105835392 | 3300028047 | Forest Soil | TLFSGYRDEEALRLLDEHQAPVNPLIQIAPTNDSLQETRA |
| Ga0302219_100037958 | 3300028747 | Palsa | FNSLGGFLATVKGTLFSRYRDDEALRMLEEAVAAVHPLVQIEVPETLQGTRV |
| Ga0265338_112045212 | 3300028800 | Rhizosphere | VNATFSSLSGFLATVKGTLFPGYRDAEALRMLEEPEAAVHPLVQIEAAEMAQGTRA |
| Ga0302155_101788211 | 3300028874 | Bog | RDKEALRMLEEHQAPVHPLVQIAATSTSLHETRLRETRA |
| Ga0308309_107313911 | 3300028906 | Soil | SLGGFLATVKATLFTGYRDAEALRLLEEPQAPVHPLVQIAPTSESSLQETQA |
| Ga0222749_107730531 | 3300029636 | Soil | GFLATVKGTLFPAYRDEEALRLLEEPVAAVNPLVQIAEAGETLQETRV |
| Ga0311329_101686511 | 3300029907 | Bog | KATLFGSYRDEEALRLLEEHQEPVHPLVQIAPTSESTLQGTRA |
| Ga0311361_103898511 | 3300029911 | Bog | TLFSSYRDKEALRMLDEPSAPVHPLVQIGASRDSLQQSRA |
| Ga0311359_106387412 | 3300029914 | Bog | ATVKATLFGSYRDEEALRLLEEHQEPVHPLVQIAPTSESTLQGTRA |
| Ga0311340_113050581 | 3300029943 | Palsa | VKGTLFTGYRDEDALRLLDEPEIPVPALVQIETTNESLQETRA |
| Ga0311352_112436591 | 3300029944 | Palsa | SYRDQEALRLLEEPQAPVHPLVQIATTHEPLEETRA |
| Ga0311342_103372811 | 3300029955 | Bog | KATLFTSYQDKEALRMLDEPPAPIHPLVQIATQSEPLHESRA |
| Ga0302282_12732432 | 3300030045 | Fen | ATLFSSYRDKEALRLLDEPQAPVHPLVQIATTTESLHETRA |
| Ga0302176_104377401 | 3300030057 | Palsa | LEGFLATVKATLFTGYRDEEALRLLDEPQGPVHPLVQISAPKDSLQETSA |
| Ga0311353_103586263 | 3300030399 | Palsa | TRYRDEEALRLLDEPQAPVHPLVQIATTTEPLHETRA |
| Ga0311370_100582708 | 3300030503 | Palsa | SLSGFLARVKATLFSSYRDEEALRLLEEHQAPVHPLVQIAPTNDSLQETRA |
| Ga0302183_100945771 | 3300030509 | Palsa | SSLGGFLATVKATLFPSYRDEEALRLLDEPQAPVHPLVQIATTHEPLEETRA |
| Ga0302275_102477451 | 3300030518 | Bog | GGFLATVKATLFSSYRDKEALRLLDEPQAPVHPLVQIATTTESLHETRA |
| Ga0311354_110767381 | 3300030618 | Palsa | FNSLGGFLATVKGTLFTSYQDKEALRMLEEPQPAVHPLVQIAVPETMQGTRA |
| Ga0302316_100881941 | 3300030646 | Palsa | SSLSGFLATVKATLFTSYRDKEALRLLDEPQAPVHPLVQIAPNDSLQETRA |
| Ga0310039_103588492 | 3300030706 | Peatlands Soil | GYRDDEALHMLEEPQAPVHPLIQIEPPSETASLQQTRA |
| Ga0265460_124959081 | 3300030740 | Soil | LATVKATLFDSYRDEEALRLLDEPQAPVHPLVQISTTSESSLQETRA |
| Ga0265461_108397483 | 3300030743 | Soil | ATVKATLFTSYRDEEALRLLDEPQAPVHPLVQIAASNGSNASLQETGA |
| Ga0265753_10492812 | 3300030862 | Soil | GTLFTSYRDEEALRLLDEPAAPVHPLVQIAPPSESMQGTHV |
| Ga0073994_100532501 | 3300030991 | Soil | SLGGFLATVKGTLFSGYQDEEALRLLEEPQAAVHPLVQIAAPSETLHETRA |
| Ga0073994_120613753 | 3300030991 | Soil | TLFTSYRDDEALRLLDEPQAPVHPLVQITATNDSLQETRA |
| Ga0170834_1074133551 | 3300031057 | Forest Soil | VKATLFSSYRDDAALKMLDEPVAAIHPLVQISTPSSSMQETGA |
| Ga0170822_165557701 | 3300031122 | Forest Soil | PAYRDDEALRMLEEPAAAVHPLVQIAPTSQAESLQETRA |
| Ga0302325_128441432 | 3300031234 | Palsa | GGFLATVKATLFTSYRDEEALRLLDEPQAPVHPLVQIAPTNEPLQETRA |
| Ga0302324_1010825371 | 3300031236 | Palsa | FLATVKATLFTSYQDKEALRMLDEPPAPIHPLVQIATQSEPLHESRA |
| Ga0265316_109140991 | 3300031344 | Rhizosphere | DDEALRMLEEPVAAVHPLVQIGAAAQAESLQETQA |
| Ga0170820_120510101 | 3300031446 | Forest Soil | ATVKGTLFSRYRDDEALRLLEEPVAAVHPLVQIAAPGETLHETRA |
| Ga0310686_1059443202 | 3300031708 | Soil | FTSYRDEEALRLLDEPAAPVHPLVQIAPTSEVSRSLQETRG |
| Ga0310686_1089018801 | 3300031708 | Soil | FTTYRDKEALDLLDEPQAPVHPLVQIAPTTESLGTRA |
| Ga0307476_111393982 | 3300031715 | Hardwood Forest Soil | TFNSLGGFLATVKGTLFSQYRDEEALRLLEEPVAAVNPLVQIAAPEGMQETRV |
| Ga0307474_110575702 | 3300031718 | Hardwood Forest Soil | ATVKATLFTGYRDEEALRLLDEPQAPVHPLVQIAATSEPQGTRA |
| Ga0307477_100463905 | 3300031753 | Hardwood Forest Soil | YKDEEALRMLEEPQAPVNPLIQIATPTDTLQETRA |
| Ga0307477_107011811 | 3300031753 | Hardwood Forest Soil | FLATVKGTLFSRYRDDEALRLLEEPQAAVHPLVQIAAPESVHETRA |
| Ga0307477_110495131 | 3300031753 | Hardwood Forest Soil | VKATLFTSYRDEEALRLLEEHQAPVHPLVQIAATNDSLQETRA |
| Ga0307475_101444344 | 3300031754 | Hardwood Forest Soil | KATLSTGYRDDEALRMLEETTAPLHPLVHIAGASESSASLQGTSV |
| Ga0307475_104025543 | 3300031754 | Hardwood Forest Soil | DTVKATLFTSYRDEEALRLLEEHQAPVHPLVQIAATNDSLQETRA |
| Ga0307475_113853471 | 3300031754 | Hardwood Forest Soil | FTGYRDAEALRLLEEPQAPVHPLVQIASTGDSLQETRA |
| Ga0307478_102835701 | 3300031823 | Hardwood Forest Soil | GFLATVKGTLFTRYRDDEALRMLEEPQAAVHPLVQISHASDTLQETRV |
| Ga0307478_107388561 | 3300031823 | Hardwood Forest Soil | YRDDEALRMLEEPVAAVHPLVQIASTGETLQETRV |
| Ga0302315_101351921 | 3300031837 | Palsa | SSLGGFLATVKATLFGSYRDEEALRLLEEHQAPVHPLVQIAPTSESTLQGTRA |
| Ga0316049_1111441 | 3300031866 | Soil | RDEEALRLLDEPQAPVHPLVQISTTSESSLQETRA |
| Ga0306921_105204401 | 3300031912 | Soil | LATVKATLFTAYKDEEALRMLDEPQAPIHPLIQITPPANHSRDMEQSRA |
| Ga0310910_105297343 | 3300031946 | Soil | FLATVKATLFTGYKDEEALRMLEEPEAPIHPLIQISPQAESLHESRA |
| Ga0307479_113166153 | 3300031962 | Hardwood Forest Soil | FNSLGGFLATVKATLFTTYKDEDALRMLEEPQAPVNPLIQIATPTDTLQETRA |
| Ga0335082_100379771 | 3300032782 | Soil | VKATLFTGYNDEEALRMLEEPQAPIHPLIQISPTAETLHESRA |
| Ga0335079_112639771 | 3300032783 | Soil | LATVKATLFTGYKDDEALRMLDVPEAPVNPLIQITPSQSARHDLQETRA |
| Ga0335080_102692754 | 3300032828 | Soil | TSYKDEEALRMLEEPEAPVHPLIQIAPTHSTSNKLQETRA |
| Ga0335070_104377273 | 3300032829 | Soil | LFTSYKDEEALRMLDEPQAPIHPLIQIAPSQSASHNLQETRA |
| Ga0335081_126948891 | 3300032892 | Soil | FLATVKATLFTKYEDKDALRMLDEPTAPVNPLIQINPTQQNASRDLQETRA |
| Ga0335069_105815341 | 3300032893 | Soil | SLSGFLATVRATLFSRYPDKEAERMLEDRVAPVHPLVQIAPSNEMQGTRA |
| Ga0335073_108333411 | 3300033134 | Soil | KAYMFTGYRDKQALRMLEEPVAPVHPLVQIAPTSESLQTHA |
| Ga0335073_115439303 | 3300033134 | Soil | GGFLATVRATLFTGYKDDEALKMLDEPEAPVHPLIQITPTSSESNLLETRA |
| Ga0326727_104519831 | 3300033405 | Peat Soil | ASAVHATFNSLGGFLATVKGTLFPRYRDEEALRMLEEPVAAVHPLVQIAATSETLQETRV |
| Ga0326727_112472111 | 3300033405 | Peat Soil | AVHATFNSLGGFLATVKGTLFPRYRDEEALRMLEEPVAAVHPLVQITPTSETLQETQA |
| Ga0370515_0489957_2_160 | 3300034163 | Untreated Peat Soil | SLGGFFATVKATLFGTYRDEEALRLLEEHQAPVHPLVQIAPTSESTLQGTRA |
| ⦗Top⦘ |