Basic Information | |
---|---|
Taxon OID | 3300022652 Open in IMG/M |
Scaffold ID | Ga0232059_1089300 Open in IMG/M |
Source Dataset Name | Metatranscriptome of anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaT_3 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 745 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass → Anaerobic Ammonium Oxidizing Microbial Communities From Anammox Membrane Bioreactor (Mbr) In Uc Berkley, California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 37.8719 | Long. (o) | -122.2585 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F099502 | Metagenome / Metatranscriptome | 103 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0232059_10893002 | F099502 | N/A | GDSNMTKQTNADQESAIGAILGWGGLGLFALWFAWQVGSPLIIGEKWANKQNDAIEVVKNMKPNGTESLYDMIRAFSLKAKENDFFVGEFSWSAIQREGPEYEVTLLWTEGQAKKVAIWRVNLDNKEIRPQGEAAGLPQRLAAGPPAKGSTPK |
⦗Top⦘ |