Scaffold Ga0236339_1261756

Overview

Basic Information

• Taxon OID: 3300022650
• Scaffold ID: Ga0236339_1261756
• Source Dataset Name: Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Laval University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 534
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location

• Location Name: SAS2a, Kuujjuarapick, Canada
• Coordinates
  • Lat. (^o): 55.1491
  • Long. (^o): -77.4866

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057052	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0236339_12617562	F057052	N/A	LGISGVLVGVLALGYWLGASRTVKASSYDSEKGDVEFQMTGVNESSSLLVYQPGTKTLYVYRGATVGNSALQCSYKFQMDRPGAVIQRVSCPVQSLIP