NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057052

Metagenome / Metatranscriptome Family F057052

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057052
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 102 residues
Representative Sequence MEKVWEWTRNGLAILGVLALGFWLGAGRTVNASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGHVIRRIPCGVQQLNP
Number of Associated Samples 94
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.13 %
% of genes near scaffold ends (potentially truncated) 33.82 %
% of genes from short scaffolds (< 2000 bps) 71.32 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.794 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(26.471 % of family members)
Environment Ontology (ENVO) Unclassified
(68.382 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(55.882 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 18.80%    β-sheet: 20.30%    Coil/Unstructured: 60.90%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF00425Chorismate_bind 35.29
PF00117GATase 8.09
PF04715Anth_synt_I_N 4.41
PF00156Pribosyltran 2.21
PF07681DoxX 0.74
PF13185GAF_2 0.74
PF13493DUF4118 0.74
PF07228SpoIIE 0.74
PF01116F_bP_aldolase 0.74
PF05163DinB 0.74
PF03951Gln-synt_N 0.74
PF07642BBP2 0.74
PF13426PAS_9 0.74
PF00005ABC_tran 0.74
PF13442Cytochrome_CBB3 0.74
PF12704MacB_PCD 0.74
PF05685Uma2 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 136 Family Scaffolds
COG0147Anthranilate/para-aminobenzoate synthases component IAmino acid transport and metabolism [E] 8.82
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 0.74
COG0191Fructose/tagatose bisphosphate aldolaseCarbohydrate transport and metabolism [G] 0.74
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.74
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.74
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.74
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.79 %
UnclassifiedrootN/A2.21 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003320|rootH2_10088098All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682147Open in IMG/M
3300003320|rootH2_10227437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1007Open in IMG/M
3300005529|Ga0070741_10000028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068524942Open in IMG/M
3300009519|Ga0116108_1026690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1934Open in IMG/M
3300009524|Ga0116225_1133237All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1139Open in IMG/M
3300009547|Ga0116136_1067302All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii970Open in IMG/M
3300009616|Ga0116111_1000064All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae97040Open in IMG/M
3300009623|Ga0116133_1084490All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii800Open in IMG/M
3300009628|Ga0116125_1005802All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3574Open in IMG/M
3300009628|Ga0116125_1106416All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii753Open in IMG/M
3300009630|Ga0116114_1126135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii665Open in IMG/M
3300009631|Ga0116115_1175119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii543Open in IMG/M
3300009636|Ga0116112_1026099All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1907Open in IMG/M
3300009644|Ga0116121_1051065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1301Open in IMG/M
3300009645|Ga0116106_1077016All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1090Open in IMG/M
3300009665|Ga0116135_1064189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1290Open in IMG/M
3300009665|Ga0116135_1158595All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii848Open in IMG/M
3300009665|Ga0116135_1474874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii516Open in IMG/M
3300009762|Ga0116130_1091463All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii955Open in IMG/M
3300009824|Ga0116219_10804733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii512Open in IMG/M
3300010341|Ga0074045_10651338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii670Open in IMG/M
3300010343|Ga0074044_10544649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii758Open in IMG/M
3300010359|Ga0126376_11175184All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii780Open in IMG/M
3300010371|Ga0134125_13117723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii502Open in IMG/M
3300014151|Ga0181539_1120126All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1080Open in IMG/M
3300014156|Ga0181518_10025159All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00683981Open in IMG/M
3300014160|Ga0181517_10043060All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2831Open in IMG/M
3300014160|Ga0181517_10099794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681690Open in IMG/M
3300014161|Ga0181529_10160153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1359Open in IMG/M
3300014162|Ga0181538_10160745All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1282Open in IMG/M
3300014162|Ga0181538_10603333All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii573Open in IMG/M
3300014169|Ga0181531_10053951All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2352Open in IMG/M
3300014169|Ga0181531_10831360All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii577Open in IMG/M
3300014199|Ga0181535_10004323All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae15901Open in IMG/M
3300014199|Ga0181535_10077222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682193Open in IMG/M
3300014199|Ga0181535_10375712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii836Open in IMG/M
3300014200|Ga0181526_10224860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1198Open in IMG/M
3300014491|Ga0182014_10186045All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1135Open in IMG/M
3300014494|Ga0182017_10683208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii622Open in IMG/M
3300014638|Ga0181536_10480316All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii543Open in IMG/M
3300014654|Ga0181525_10904474Not Available501Open in IMG/M
3300014655|Ga0181516_10454030All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii656Open in IMG/M
3300014838|Ga0182030_10003835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae32088Open in IMG/M
3300014838|Ga0182030_10284038All Organisms → cellular organisms → Bacteria → Acidobacteria1845Open in IMG/M
3300014839|Ga0182027_10001151All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae44331Open in IMG/M
3300016750|Ga0181505_10827206All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii539Open in IMG/M
3300017821|Ga0187812_1000426All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE006814857Open in IMG/M
3300017925|Ga0187856_1000717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae28616Open in IMG/M
3300017931|Ga0187877_1003847All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae11920Open in IMG/M
3300017931|Ga0187877_1011828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5311Open in IMG/M
3300017931|Ga0187877_1025857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3038Open in IMG/M
3300017931|Ga0187877_1347088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii564Open in IMG/M
3300017935|Ga0187848_10257177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii736Open in IMG/M
3300017940|Ga0187853_10115085All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1312Open in IMG/M
3300017940|Ga0187853_10147368All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1129Open in IMG/M
3300017946|Ga0187879_10082582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1855Open in IMG/M
3300017946|Ga0187879_10133566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1410Open in IMG/M
3300017946|Ga0187879_10570061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii629Open in IMG/M
3300017946|Ga0187879_10709461All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii560Open in IMG/M
3300017948|Ga0187847_10048300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682442Open in IMG/M
3300017948|Ga0187847_10090763All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1691Open in IMG/M
3300017988|Ga0181520_10010673All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae12252Open in IMG/M
3300017988|Ga0181520_10044598All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00684324Open in IMG/M
3300017988|Ga0181520_11052076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii536Open in IMG/M
3300017996|Ga0187891_1001111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae23957Open in IMG/M
3300018003|Ga0187876_1181258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii717Open in IMG/M
3300018004|Ga0187865_1182016All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii722Open in IMG/M
3300018013|Ga0187873_1102032All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1135Open in IMG/M
3300018014|Ga0187860_1283515All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii647Open in IMG/M
3300018014|Ga0187860_1370299All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii542Open in IMG/M
3300018016|Ga0187880_1124078All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681243Open in IMG/M
3300018020|Ga0187861_10129050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1187Open in IMG/M
3300018021|Ga0187882_1425535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii503Open in IMG/M
3300018022|Ga0187864_10228069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii866Open in IMG/M
3300018022|Ga0187864_10475039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii528Open in IMG/M
3300018037|Ga0187883_10292109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii833Open in IMG/M
3300018037|Ga0187883_10364523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii739Open in IMG/M
3300018037|Ga0187883_10594352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii574Open in IMG/M
3300018042|Ga0187871_10443411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii717Open in IMG/M
3300018044|Ga0187890_10481118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii698Open in IMG/M
3300018044|Ga0187890_10639437All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii600Open in IMG/M
3300018046|Ga0187851_10113824All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1668Open in IMG/M
3300018046|Ga0187851_10730821All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii557Open in IMG/M
3300018057|Ga0187858_10604415All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii661Open in IMG/M
3300022524|Ga0224534_1085535All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii567Open in IMG/M
3300022650|Ga0236339_1261756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii534Open in IMG/M
3300023068|Ga0224554_1000577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE006829432Open in IMG/M
3300023068|Ga0224554_1042389All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1229Open in IMG/M
3300023088|Ga0224555_1000027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae177210Open in IMG/M
3300023090|Ga0224558_1040464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2007Open in IMG/M
3300025434|Ga0208690_1028273All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii922Open in IMG/M
3300025444|Ga0208189_1067279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii656Open in IMG/M
3300025446|Ga0208038_1091771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii513Open in IMG/M
3300025469|Ga0208687_1044550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1111Open in IMG/M
3300025498|Ga0208819_1084491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii686Open in IMG/M
3300027854|Ga0209517_10133146All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681617Open in IMG/M
3300027855|Ga0209693_10633325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii503Open in IMG/M
3300028762|Ga0302202_10355070All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii691Open in IMG/M
3300028765|Ga0302198_10074039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1950Open in IMG/M
3300028800|Ga0265338_10008444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE006812505Open in IMG/M
3300028800|Ga0265338_10138921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1906Open in IMG/M
3300029954|Ga0311331_10020521All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10216Open in IMG/M
3300030594|Ga0210280_1181929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii526Open in IMG/M
3300030659|Ga0316363_10197967All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii839Open in IMG/M
3300031241|Ga0265325_10009212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685779Open in IMG/M
3300031247|Ga0265340_10040361All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2299Open in IMG/M
3300031259|Ga0302187_10016074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00685348Open in IMG/M
3300031344|Ga0265316_10958110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii596Open in IMG/M
3300031708|Ga0310686_107756795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682361Open in IMG/M
3300031823|Ga0307478_11353055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii591Open in IMG/M
3300032160|Ga0311301_10584561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1617Open in IMG/M
3300032160|Ga0311301_10751454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1354Open in IMG/M
3300032515|Ga0348332_11423530All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii944Open in IMG/M
3300032805|Ga0335078_10408633All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1779Open in IMG/M
3300032805|Ga0335078_10540451All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1486Open in IMG/M
3300032805|Ga0335078_12463854All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii538Open in IMG/M
3300032893|Ga0335069_10293434All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1938Open in IMG/M
3300032893|Ga0335069_10840652All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1031Open in IMG/M
3300032895|Ga0335074_10066778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4876Open in IMG/M
3300032895|Ga0335074_10128300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3267Open in IMG/M
3300032895|Ga0335074_10446934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1373Open in IMG/M
3300032896|Ga0335075_10348027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1615Open in IMG/M
3300032896|Ga0335075_10483144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1275Open in IMG/M
3300032896|Ga0335075_10975793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii764Open in IMG/M
3300032896|Ga0335075_11501995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii561Open in IMG/M
3300032898|Ga0335072_10005550All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae18573Open in IMG/M
3300032898|Ga0335072_10032076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00687287Open in IMG/M
3300032898|Ga0335072_10102634All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii3652Open in IMG/M
3300032898|Ga0335072_10478210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1301Open in IMG/M
3300033134|Ga0335073_11397776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii684Open in IMG/M
3300033402|Ga0326728_10150674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2523Open in IMG/M
3300033405|Ga0326727_10701056All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans809Open in IMG/M
3300033755|Ga0371489_0008105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE006810263Open in IMG/M
3300033823|Ga0334837_000171All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae56167Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland26.47%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland14.71%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog13.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil12.50%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.41%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.41%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.68%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.94%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.21%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.21%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.47%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.47%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.47%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil1.47%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.74%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003320Sugarcane root Sample H2Host-AssociatedOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300022650Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025434Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
rootH2_1008809823300003320Sugarcane Root And Bulk SoilMNATVSWLKSIFALAAVLALGLWLGAAHTAKASSDDDGAGVQFQLTSGINPESSLLVYQPGTKTVYVYQGATTGNNALQCSFMYQLTRPGEVIHRIPCRVPSLTP*
rootH2_1022743713300003320Sugarcane Root And Bulk SoilMEKPASWLKATFALAAVLALGIWLGAAHTAKASGDDDGAGVQFQLTSGVSPASSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLTRPGEVIHRVPCRIPSLNP*
Ga0070741_100000281413300005529Surface SoilMGKAVVWIRSGLGVSLAFIGVLALGFWLGAGHTAKASSDDDGAGVQFQLTGVNPTSSLLVYQPGTKTVYVYQGATTGNNALQCSFMFQLTRPGEVIHRIPCRLPSLMP*
Ga0116108_102669023300009519PeatlandMEKAWEWTRNGLAIVGVLAFGFWLGAGRTVSASSYQSSSSDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP*
Ga0116225_113323723300009524Peatlands SoilMGKVWGWARNGLAIIGVLAVGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKSGQVIRRIPCGVQQLNP*
Ga0116136_106730223300009547PeatlandMEKAWEWTRNGLAIVGVLAFGFWLGAGRTVSASSYQSSSSDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCGAQQLNP*
Ga0116111_100006493300009616PeatlandLALGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVIRRIPCGVQQLNP*
Ga0116133_108449013300009623PeatlandMEKVWNWARNGLALGAVLAFGFWLGAGRTVNASSNQSGGGDVEFQLTGISPTSSLLVYQPGSKTVYVYQGATTGNDALQCSFVFQLDRPGQVIRRSSCGVQQLIP*
Ga0116125_100580223300009628PeatlandMEKVWEWTRNGLAILGVLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP*
Ga0116125_110641623300009628PeatlandVNKALAWTKNCLALLGVLALGFWLGTGRNVNASSNGSGGDVEFQLTGVNETSSLLVYQPGDKTVYVYQGATTGNSSLQCSYMYQLDRPGRVIRRIPCEVHDLIP*
Ga0116114_112613513300009630PeatlandLGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP*
Ga0116115_117511913300009631PeatlandMEKAWEWTRNGLAILGLLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP*
Ga0116112_102609923300009636PeatlandLALGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKRGQVIRRIPCGVQQLNP*
Ga0116121_105106513300009644PeatlandMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQASGGDVEFQLIGISPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVI
Ga0116106_107701623300009645PeatlandMEKAWEWTRNGLAIVGVLAFGFWLGAGRTVSASSYQSSSSDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAMQQLNP*
Ga0116135_106418923300009665PeatlandMKAGWEWTRNGLALVGVLALGFWLGAGRTVKASSAESSAGDVEFQLTNVGPASSLLVYQPRTNTVYVYQGATTGNSALQCSFMYQLQRPGDVIRRVPCDVQRLIP*
Ga0116135_115859523300009665PeatlandVNKALAWTKNCLALLGVLALGFWLGTGRNVNASSNGSGGDVEFQLTGVNETSSLLVYQPGDKTVYVYQGATTGNSSLQCSYMYQLDRPGRVIR
Ga0116135_147487423300009665PeatlandVEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQASGGDVEFQLIGISPTSSLLVYQPGTKTVYVYQGATTGNDALQCSFVFQLDRPGQVIRRSSCGVQQLIP
Ga0116130_109146323300009762PeatlandMEKVWEWTRNGLAILGVLALGFWLGSGRTVSASTYQSDGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGN
Ga0116219_1080473313300009824Peatlands SoilMGKVWRWARNGLAIIGVLAVGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVIRRIPCGVQQLNP*
Ga0074045_1065133823300010341Bog Forest SoilMGKLWDWARNGLALGAVLAFGFWLGAGRTVNASSNQSSGGDVEFQLTGINPTSSLLVYQPGSKTVYVYQGATTGNDAMQCSFMFQLDKPGQVIRRVPCGAQQLIP*
Ga0074044_1054464923300010343Bog Forest SoilMKTAWGWTRDGLALIGVLALGFWLGAGRTVSASSTESNMGDVEFQLTSVEPSSSLLVYQPRTNTVYVYQGATTGNSALQCSFMFQLQRPGDVIRRIPCDVQRLIP*
Ga0126376_1117518423300010359Tropical Forest SoilMGKATVWMRSGLAVSLAFIGVLVLGFWLGSGRAAKASSDEDGAGVQFQLTGVNPTSSLLVYQPGTKTVYVYQGATTGNNALQCSFMFQLTRPGEVIHRVPCRVPSLNP*
Ga0134125_1311772313300010371Terrestrial SoilMQQGLAWVRNVLALVAVLAVGLWLGSTRTVKAQSYQLDGDVQFQLAGVNERSSLLVYRPGSKTLYVYQGATTGNSELQCSLMFKIGRPGSAIRRVNCAPGELTR*
Ga0181539_112012623300014151BogMEKVWGWARNGLALVGVLALGFWLGAGRTVNASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCGVQQLNP*
Ga0181518_1002515963300014156BogMEKVWEWTRNGLAILGLLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP*
Ga0181517_1004306033300014160BogMEKAWGWTRNGLALAGVLATGFWLGAGRTVNASSYQSGGGEVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP*
Ga0181517_1009979423300014160BogMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQASGGDVEFQLIGISPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVIRRIPCAVQQLNP*
Ga0181529_1016015323300014161BogMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQSSTGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNDALQCSFMFQLNKPGQVIRRIPCAVQQLNP*
Ga0181538_1016074523300014162BogMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQASGGDVEFQLTGISPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPG
Ga0181538_1060333313300014162BogLAILGVLALGFWLGSGRTVNASTYQTSGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNDALQCSFMFQLNKPGQVIRRIPCAVQQLNP*
Ga0181531_1005395133300014169BogMKPVWEWTRNGLALIALVALGFWLGAGRAVNASSGESSMGDVQFQLTNVEPSSSLLVYQPRTKTVFVYLGATTGNSAVQCAYMFQLQRPGDVIRRVPCAVPQLNP*
Ga0181531_1083136013300014169BogNPLRLLEKSALPEGEMKAGWEWTRNGLALVGVLALGFWLGAGRTVKASSAESSAGDVEFQLTNVGPASSLLVYQPRTNTVYVYQGATTGNSALQCSSMYQLQRPGDVIRRVPCDVQRLIP
Ga0181535_1000432323300014199BogMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQSSAGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNDALQCSFMFQLNKPGQVIRRIPCAVQQLNP*
Ga0181535_1007722223300014199BogMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQASGGDVEFQLTGISPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVIRRIPCAVQQLNP*
Ga0181535_1037571223300014199BogMKAGWEWTRNGLALVGVLALGFWLGAGRTVKASSAESSAGDVEFQLTNVGPASSLLVYQPRTNTVYVYQGATTGNSALQCSFMYQLQRPGDVIRRVP
Ga0181526_1022486023300014200BogHSEGNAMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQTSGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNDALQCSFMFQLNKPGQVIRRIPCAVQQLNP*
Ga0182014_1018604523300014491BogLALVGVLAVGFWLGSGRTVKASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCEVQRLNP*
Ga0182017_1068320813300014494FenMGEDAMEKAWEWTRNGLAILGVLAAGFWLGAGRTVNASSYQSGGGDVEFQLTGINETSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCEVQRLNP*
Ga0181536_1048031613300014638BogMSGSVRACVFGARHPQREDAMEKVWGWGRNGLALVGILALGFWLGEDRTVRASSYDSGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLNKPGNVIRRNPCAVQQLIP*
Ga0181525_1090447413300014654BogMKPVWEWTRNGLALIALVALGFWLGAGRAVNASSGESSMGDVQFQSTNVEPSSSLLVYQPRTKTVFVYLGATTGNSAVQCAYMFQLQRP
Ga0181516_1045403013300014655BogMKPVWEWTRNGLALIALVALGFWLGAGRAVNASSGESSMGDVQFQSTNVEPSSSLLVYQPRTKTVFVYLGATTGNSAVQCAYMFQLQRPGDVIRRVPCAVPQLNP*
Ga0182030_10003835233300014838BogMHGEDEMGKVWEWTRNGLALVGVLALGFWLGSGRTVNASSNQSSGGDVEFQLTGINETSSLLVYQPGTKTVYVYQGATTGNAMLQCSFMFQLDKPGNVIRRIPCGLPQLNP*
Ga0182030_1028403843300014838BogMEKAWGWTRNGLALAGVLATGFWLGAGRTVNASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP*
Ga0182027_10001151223300014839FenMGAVWGWTRNGLALVGVLAVGFWLGSGRTVKASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCEVQRLNP*
Ga0181505_1082720613300016750PeatlandGNAMEKVWEWTRNGLAILGVLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187812_100042633300017821Freshwater SedimentVEKAFVWMRNGLALVGVLALGFWLGSGRTVSASSYDSGQGVQFQLAGVDHSSSLLVYHPGTKTVYVYQGAMVGNAALQCTYMFQMTNPGDVIRRVPCAVQRLIP
Ga0187812_121110023300017821Freshwater SedimentEKMDKAWDWTRNGLAVVGVLALGFWFGAGRTVKASSYDSGGIGVQFQLAGLSESSALLVYQPETKTVYVYQGATQGNAALQCTYMFHMDRPGGVIRRIPCAVPQLNP
Ga0187856_100071723300017925PeatlandMEKAWEWTRNGLAIVGVLAFGFWLGAGRTVSASSYQSSSSDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187877_100384733300017931PeatlandMGKVWRCGRNGLAVIGLLALGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVIRRIPCGVQQLNP
Ga0187877_101182863300017931PeatlandMEKAWEWTRNGLAIVGVLAFGFWLGAGRTVSASSYQSSSSDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQ
Ga0187877_102585733300017931PeatlandMEKVWNWARNGLALGAVLAFGFWLGAGRTVNASSNQSGGGDVEFQLTGISPTSSLLVYQPGSKTVYVYQGATTGNDALQCSFVFQLDRPGQVIRRSSCGVQQLIP
Ga0187877_134708813300017931PeatlandMEKVWEWTRNGLAILGVLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187848_1025717723300017935PeatlandMEKVWDSAKSGLALVGVLALGFWLGVGRTVNASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGHVIRRIPCGVQQLNP
Ga0187853_1011508523300017940PeatlandMGAVWGWTRNGLALVGVLAVGFWLGAGRTVKASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187853_1014736813300017940PeatlandMEKAWGWTRNGLALAGVLATGFWLGAGRTVNASSYQSGGGEVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187879_1008258223300017946PeatlandMEKVWEWTRNGLAILGLLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187879_1013356623300017946PeatlandMKAGWEWTRNGLALVGVLALGFWLGAGRTVKASSAESSAGDVEFQLTNVGPASSLLVYQPRTNTVYVYQGATTGNSALQCSFMYQLQRPGDVIRRVPCDVQRLIP
Ga0187879_1057006123300017946PeatlandMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQASGGDVEFQLIGISPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVIRRIPCAVQQLNP
Ga0187879_1070946113300017946PeatlandASLGKGIHSEGNAMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQTSGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNDALQCSFMFQLNKPGQVIRRIPCAVQQLNP
Ga0187847_1004830023300017948PeatlandMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQTSGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNDALQCSFMFQLNKPGQVIRRIPCAVQQLNP
Ga0187847_1009076323300017948PeatlandMEKVWEWTRNGLAIQGVLALGFWLGSGRTVNASTYQASGGDVEFQLTGISPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVIRRIPCAVQQLNP
Ga0181520_1001067323300017988BogMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQSSAGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNDALQCSFMFQLNKPGQVIRRIPCAVQQLNP
Ga0181520_1004459853300017988BogMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQASGGDVEFQLTGISPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVIRRIPCAVQQLNP
Ga0181520_1105207613300017988BogMEKVWEWTRNGLAILGLLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCA
Ga0187891_1001111213300017996PeatlandMEKVWDWARNGLALAGVLAVGFWLGAGRTVNASSYQSGGSDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAAQQLNP
Ga0187876_118125813300018003PeatlandMEKVWEWTRNGLAILGVLALGFWLGAGRTVNASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGHVIRRIPCGVQQLNP
Ga0187865_118201613300018004PeatlandMEKVWEWTRNGLAILGVLAFGFWLGAGRTVSASSYQSSSSDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187873_110203223300018013PeatlandEKAWEWTRNGLAIVGVLAFGFWLGAGRTVSASSYQSSSSDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187860_128351513300018014PeatlandMEKVWGWAKNGLALVGVLALGFWLGAGRTVNASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGHVIRRIPCGVQQLNP
Ga0187860_137029913300018014PeatlandAMEKVWNWARNGLALGAVLAFGFWLGAGRTVNASSNQSGGGDVEFQLTGISPTSSLLVYQPGSKTVYVYQGATTGNDALQCSFVFQLDRPGQVIRRSSCGVQQLIP
Ga0187880_112407823300018016PeatlandMEKVWGWGRNGLALVGILALGFWLGEDRTVRASSYDSGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLNKPGNVIRRNPCAVQQLIP
Ga0187861_1012905023300018020PeatlandMEKAWEWTRNGLAIVGVLAFGFWLGAGRTVSASSYQSSSSDVESQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGQVIRRIPCGVQQLNP
Ga0187882_142553513300018021PeatlandVLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187864_1022806913300018022PeatlandMEKVWGWGRNGLALVGILALGFWLGEDRTVRASSYDSGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLNKPG
Ga0187864_1047503913300018022PeatlandMEKVWGWAKNGLALVGVLALGFWLGVGRTVNASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCGAQQLNP
Ga0187883_1029210923300018037PeatlandLALGFWLGSGRTVNASTYQTSGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNDALQCSFMFQLNKPGQVIRRIPCAVQQLNP
Ga0187883_1036452313300018037PeatlandMKAGWEWTRNGLALVGVLALGFWLGAGRTVKASSAESSAGDVEFQLTNVGPASSLLVYQPRTNTVYVYQGATTGNSALQCSFMYQLQRPGDVIRRVPCD
Ga0187883_1059435213300018037PeatlandVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQASGGDVEFQLIGISPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLGKPGQVIRRIPCAVQQLNP
Ga0187871_1044341113300018042PeatlandMVKTLLWTRNGLALVGILALGFWFGASRTVKASSYESNGLGIQLQLTGVSESSALLVYQPDTKTVYVYQGATLGNAALQCTYMFHMDRPGGVIRRLPCGVQSLNP
Ga0187871_1077898813300018042PeatlandMKAGWEWTRNGLALVGVLALGFWLGAGRTVKASSAESSAGDVEFQLTNVGPASSLLVYQPRTNTVYVYQGATTGNSALQCSFMYQL
Ga0187890_1048111813300018044PeatlandNGLALAGVLATGFWLGAGRTVNASSYQSGGGEVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187890_1063943723300018044PeatlandVNKALAWTKNCLALLGVLALGFWLGTGRNVNASSNGSGGDVEFQLTGVNETSSLLVYQPGDKTVYVYQGATTGNSSLQCSYMYQLDRPGRVIRRIPCEVHDLIP
Ga0187851_1011382413300018046PeatlandAMEKVWEWTRNGLAILGVLALGFWLGSGRTVNASTYQTSGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNDALQCSFMFQLNKPGQVIRRIPCAVQQLNP
Ga0187851_1073082113300018046PeatlandAIRNSRAATTTLASFGKGIHSEGDAMEKVWEWTRNGLAILGLLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0187858_1060441513300018057PeatlandMGKVWRCGRNGLAVIGLLALGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKP
Ga0224534_108553513300022524SoilMEKVWEWTRNGLALLGVLAAGFWLGSGRTVNASSYQSGGGDVEFQLTGINETSSLLVYQPGTKTVYVYQGATTGNAMLQCSFMFQLDKPGQVIR
Ga0236339_126175623300022650FreshwaterLGISGVLVGVLALGYWLGASRTVKASSYDSEKGDVEFQMTGVNESSSLLVYQPGTKTLYVYRGATVGNSALQCSYKFQMDRPGAVIQRVSCPVQSLIP
Ga0224554_1000577243300023068SoilMEKAWGWTRNGLALAGVLATGFWLGAGRTVNASSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0224554_104238923300023068SoilMEKTLMWVRNGLALLGVLALGFWLGAGRTVKASGYDPGGGDVQFQLTGLNETGSLLVYQPSTKAVYVYRGAMVGNSSLQCNFKFQMDRPGGVIYRVPCPVQSAIP
Ga0224555_1000027543300023088SoilVGVLALGFWLGSGRTVNVSSYQSGGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGQVIRRIPCGVQQLIP
Ga0224558_104046423300023090SoilMEKAWEWTRNGLAILGVLAAGFWLGAGRTVNASSYQSGGGDVEFQLTGINETSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0208690_102827313300025434PeatlandILGVLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0208189_106727913300025444PeatlandALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0208038_109177113300025446PeatlandMGKVWRCGRNGLAVIGLLALGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVIRRIPCGVQQL
Ga0208687_104455023300025469PeatlandAFGFWLGAGRTVSASSYQSSSSDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0208819_108449123300025498PeatlandMEKVWEWTRNGLAILGVLALGFWLGSGRTVSASTYQSAGGDVEFQLTAINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIR
Ga0209517_1013314623300027854Peatlands SoilMGKVWRWARNGLAIIGVLAVGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKSGQVIRRIPCGVQQLNP
Ga0209693_1063332513300027855SoilEGEMNTVWGWTRNGLALIGVLALGFWLGAGRTVNASSGDSSWGDVEFQMTSVSPTSSLLVYQPRTKTVYVYQGATTGNSALQCSFMFQLQLPGDVIRRVPCEVPRLNP
Ga0302202_1035507023300028762BogGVLALGFWLGTGRNVNASSNGSGGDVEFQLTGVNETSSLLVYQPGDKTVYVYQGATTGNSSLQCSYMYQLDRPGRVIRRIPCEVHDLIP
Ga0302198_1007403933300028765BogTVNKALAWTKNCLALLGVLALGFWLGTGRNVNASSNGSGGDVEFQLTGVNETSSLLVYQPGDKTVYVYQGATTGNSSLQCSYMYQLDRPGRVIRRIPCEVHDLIP
Ga0265338_1000844463300028800RhizosphereVNKALAWTKNCLALVGVLALGFWLGTGRNVKASSSGSGGVVEFQLTGVNETSSLLVYQPGDKTVYVYQGATTGNSALQCSYMYQLDRPGRVIRRVPCEVHDLIP
Ga0265338_1013892143300028800RhizosphereMGKVWEWTKNGLALAGVLALGFWLGSGRTVNASSYQSAGGDVEFQLTGISPTSSLLVYQPGTKTVYVYQAATTGNAALQCSFMFQLEKPGNVIRRIPCAVQQLIP
Ga0311331_1002052123300029954BogVNKALAWTKNCLALLGVLALGFWLGTGRNVNASSNGSGGDVEFQLTGVNETSSLLVYQPGDKTVYVYQGATTGNSTLQCSYMYQLDRPGRVIRRIPCEVHDLIP
Ga0210280_118192923300030594SoilDKASVRVRNVLALVGVLALGYWLGADRTVKASSYVQSGESVGFQLTGVDETSSLLVYQPATKTVYVYRGATLGNSALQCSYKFQMDKPGGVIQRLSCPVQSLIPQ
Ga0316363_1019796723300030659Peatlands SoilMGKVWGWARNGLAIIGVLAVGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKSGQVIRRIPCGVQQLNP
Ga0265325_1000921223300031241RhizosphereMGKVWEWTKNGLALAGVLALGFWLGSGRTVNASSYQSGGGDVEFQLTGISPTSSLLVYQPGTKTVYVYQAATTGNAALQCSFMFQLEKPGNVIRRIPCAVQQLIP
Ga0265340_1004036123300031247RhizosphereMGKVWEWTKNGLALAGVLALGFWLGAGRTVIASSNQSSGGDVEFQLTGISPTSSLLVYQPGTKTVYVYQAATTGNAALQCSFMFQLEKPGNVIRRIPCAVQQLIP
Ga0302187_1001607463300031259BogALAWTKNCLALLGVLALGFWLGTGRNVNASSNGSGGDVEFQLTGVNETSSLLVYQPGDKTVYVYQGATTGNSSLQCSYMYQLDRPGRVIRRIPCEVHDLIP
Ga0265316_1095811023300031344RhizosphereGLALAGVLATGFWLGAGRTVNASSYQSGGGEVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAALQCSFMFQLDKPGNVIRRIPCAVQQLNP
Ga0310686_10775679523300031708SoilMVKMWQWARNCLAFAGVLAVGFWLGADRVAGASTNQATAGDVEFQLTGISPTSSLMVYQPGTKTVYVYQGATTGNSALQCSFMFQLDRPGNVIRRVPCGVQQLNP
Ga0307478_1135305513300031823Hardwood Forest SoilMETTAKWLRNGLALAGVLALGFWLGAGRTVKASSYDSGDGVQFQLTGISPTSSLLIYQPGAKTVYVYQGATTGNAALQCSFMFQLDRPGAVVRRVPCAVANLTP
Ga0311301_1058456133300032160Peatlands SoilVLAVGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKSGQVIRRIPCGVQQLNP
Ga0311301_1075145413300032160Peatlands SoilMGKVWGWARNGLAIIGVLAVGFWLGAGRTVKASSYESGGGNVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDKPGQVIRRIP
Ga0348332_1142353023300032515Plant LitterWEWTRNGLALIAVLGLGFWLGAGRTVRASSGDSSLGDVQFQLTSVGPSSSLLVYQPRTKTVYVYLGATTGNSSVQCAYMFQLDRPGDVIRRVPCEVPRLNP
Ga0335078_1040863323300032805SoilMAQVWVWMRNGLALVGVLAIGFWLGTGRAVNASSSESGQGVQFQLTGVDRGSSLLVYHPGTKSVYVYQGAMEGNAALQCTYKFQMDRPGDVIQREGCGVQKLIP
Ga0335078_1054045113300032805SoilMRNVREWTRNAFALVGVLALGFLLGSGRTAKASSDESGGGVQFQLTGVNPTSSLLVYQPDTKTVYVYQGATTGSSSLQCSFMFQLTRPGEVIHRVPCAVPRLIP
Ga0335078_1246385423300032805SoilMGKVWEWTRNGLAIVGVLALGFWLGSGRTVNASSNQSNGGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNAMLQCSFMFQLDRPGNVIRRIPCAVQQLNP
Ga0335069_1029343423300032893SoilMESVWSWAKNGLALVGVLALGIWLGGGHAVKASSSESAGTGLQFQLAGVNPTSSLMVYHPESKTIFVYQGATTGNSALQCSFMFQIDRPGDAIRRVPCAIPRL
Ga0335069_1084065213300032893SoilMEKAWGWAKKGFALIGVLALGFWLGSARSVRASSDESASGVLQFQLTSVNPASSLLVYQPKTNTVYVYQGATIGNSALQCSFMFQLERAGQVIRRVPCEVPKLIP
Ga0335074_1006677833300032895SoilMEKFFIWLKNGLVLAGVLALGFWLGAGRTAKASSYDSGGSGVQFQLTGVDESSSLLIYQPGTKTVYVYRGATTGNAALQCSFMFQLDRPGDVVRRIPCRVASLNP
Ga0335074_1012830033300032895SoilMEKTLGSMRNVLALVGVLALGFWLGAGRTVKASSYDAGGAGVQFQLAGVNERSSLLVYQPGTKTVFVYQGATTGNSALQCSFMFQLDRPGAVIRRVPCAVQNLIP
Ga0335074_1044693413300032895SoilMAKGLAWTRNALALVGVLALGFWLGAGRTVRASSGNGNAGNLEFQLASVDQHSSLLVYQPEKQTVYVYQGATTGNAELQCSFMFQLDRPGGVIHRRNCAVGQLIP
Ga0335075_1034802723300032896SoilMEKTLGSMRNVLALVGVLALGFWLGAGRTVKASSYDTGGAGVQFQLAGVNERSSLLVYQPGTKTVFVYQGATTGNSALQCSFMFQLDRPGAVIRRVPCAVQNLIP
Ga0335075_1048314423300032896SoilMDKAVVWLRNVLALVGILALGFWLGAGRPVNASSYESGQGVQFQLAGVENSSSLLVYHPGTRTVYVYQGAMVGNAALQCTYMFQMNQPGAVIRRVPCAVQNLIP
Ga0335075_1097579323300032896SoilMDKAVVCLRNVLALVGVLALGFWLGAGRPVNASSFESGQGVQFQLAGVDHSSSLLVYHPGTKTVYVYQGAMVGNAALQCTYMFEMNQPGGVIRRVPCAVQSLIP
Ga0335075_1150199523300032896SoilMAKGLVWTRNALALVGVLALGFWLGAGRTVRASSDNGNAGNLEFQLAGVDQHSSLLVYQPEKQTVYVYQGATTGNAELQCSFMFQLDRPGGVIHRRNCAVGQLIP
Ga0335072_10005550163300032898SoilMQKALGWARNGLALAGVLAFGFWLGTSRTVKASSYESGGDVEFQLTGVNATSSLLVYQPGTKTVYVYQGATTGNSALQCSYMFQLTRPGEVIHRIPCRVPSLNP
Ga0335072_1003207623300032898SoilMEKAVQWIRNGLALTGVLALGFWLGTGRAVSASGYDSGGDVEFQLAGVNQTSALLVYQPSAKTVFVYQGATTGNSALQCSYKFQLTRPGEVIHRVSCSVPSLIP
Ga0335072_1010263433300032898SoilMHKVSVWLKNILALAGVLALGLWLDAARTAKASSDDGEGVEFQLTSGMNPTSSLLVYQPGTKTVYVYQSATTGNSALQCSFMFQLTRPGEVIHRVACRVPSLIP
Ga0335072_1047821023300032898SoilMDKASVWLKNIFALAGVLALGFWLGAGRTAKASSDDGGVQFQLTGIRPESSLLVYQPGTKTVYVYQGATTGNNALQCSFMFQLTRPGEVIRRIPCRIPSLNP
Ga0335073_1139777613300033134SoilMQTETVSGETMAKTSAWMKNALVLAGVLALGLWLGAAHTAKASSEDDGAGVQFQLTDVSPAGSLLVYQPGTNTVYVYQGATTGNNALQCSFMFQLTRPGEVIHRVPCRIPSLIP
Ga0326728_1015067423300033402Peat SoilMEKAWGWTRNGLALVGVLAVGFWLGAGRTVSASNYQSGTGDVEFQLTGINPTSSLLVYQPGTKTVYVYQGATTGNSALQCSFMFQLDRPGQVIRRIPCGVPQLNP
Ga0326727_1070105623300033405Peat SoilMEKAWGWTRNGLAVVGVLAVGFWLGSGRTVRASSYDSGGGNVGFQLTGINPTSSLLVYQPGSKTVYVYQGATTGNAALQCSFMFQL
Ga0371489_0008105_2419_27663300033755Peat SoilLEKSALPEGEMKTVWGWTRNGLALIGVSALGFWLGAGRTVNASSGESSTGDVEFQLTSVSPSSSLLVYQPRTNTVFVYEGATTGNSALQCSFMFQLQRPGDVIRRVPCDVQKLIP
Ga0334837_000171_49088_494233300033823SoilMHGEDEMGKVWEWTRNGLALVGVLALGFWLGSGRTVNASSNQSSGGDVEFQLTGINETSSLLVYQPGTKTVYVYQGATTGNAMLQCSFMFQLDKPGNVIRRIPCGLPQLNP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.