Scaffold Ga0212091_10148139

Overview

Basic Information

• Taxon OID: 3300022549
• Scaffold ID: Ga0212091_10148139
• Source Dataset Name: Cold Creek_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 927
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Segetibacter → unclassified Segetibacter → Segetibacter sp. 3557_3 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Cold Creek Source, Nevada
• Coordinates
  • Lat. (^o): 36.41
  • Long. (^o): -115.74
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021521	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212091_101481392	F021521	N/A	AVKEEKKMAGYSHRTAQPPTLAAFPPWEGSAGAGRVRPAAANIQVR